SimulationCraft 902-01

for World of Warcraft 9.0.2.36753 Live (wow build level 36753)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Monk

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-11-21 Manually set Periodic Damage Windwalker Monk Two-Hand Adjustment by 2%
Windwalker Monk Two-Hand Adjustment (effect#2) base_value 2.00 0.00
2020-11-21 Manually set Direct Damage Windwalker Monk Two-Hand Adjustment by 2%
Windwalker Monk Two-Hand Adjustment (effect#1) base_value 2.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-11-15 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

call_ot_wild : 7374 dps, 3768 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
7373.7 7373.7 10.7 / 0.145% 774.1 / 10.5% 707.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.4 10.2 Focus 0.00% 47.8 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
call_ot_wild 7374
Aimed Shot 2585 (2840) 35.1% (38.5%) 50.4 5.94sec 16955 11322 Direct 150.9 (165.3) 4196 8398 5153 22.8% (22.8%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.36 150.91 0.00 0.00 1.4976 0.0000 777569.10 1110679.70 29.99% 11321.56 11321.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.24% 116.57 82 153 4196.22 2524 9967 4195.99 3839 4497 489168 698728 29.99%
crit 22.76% 34.34 15 59 8398.03 5048 19934 8393.70 6489 10620 288401 411952 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:50.55
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 255 3.4% 0.0 0.00sec 0 0 Direct 14.4 4315 8624 5312 23.2%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 14.36 0.00 0.00 0.0000 0.0000 76314.53 109007.68 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.82% 11.03 3 18 4314.79 2524 9967 4341.63 2906 6601 47606 68000 29.99%
crit 23.18% 3.33 0 10 8624.32 5048 19934 8416.72 0 19934 28709 41008 29.13%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 369 5.0% 112.1 2.69sec 992 437 Direct 111.8 811 1621 994 22.6%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.07 111.84 0.00 0.00 2.2699 0.0000 111124.58 158730.36 29.99% 436.84 436.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.43% 86.60 63 112 810.84 774 1019 810.73 795 828 70222 100304 29.99%
crit 22.57% 25.24 11 43 1620.55 1548 2037 1620.36 1560 1700 40903 58426 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 138 1.9% 3.8 90.75sec 11023 0 Direct 3.7 9016 18035 11058 22.7%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.75 3.74 0.00 0.00 0.0000 0.0000 41384.07 41384.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.33% 2.89 0 4 9016.26 8937 9474 8954.52 0 9474 26089 26089 0.00%
crit 22.67% 0.85 0 4 18035.29 17875 18947 10928.87 0 18947 15295 15295 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.5% 22.0 13.16sec 546 0 Direct 22.0 446 892 546 22.5%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.99 21.99 0.00 0.00 0.0000 0.0000 12018.64 12018.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.48% 17.04 6 32 445.99 435 485 446.05 435 460 7600 7600 0.00%
crit 22.52% 4.95 0 15 891.92 871 969 886.23 0 969 4419 4419 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 81 1.1% 4.5 13.78sec 5440 4548 Direct 4.4 4259 9600 5483 22.9%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.47 4.43 0.00 0.00 1.1962 0.0000 24309.58 34723.80 29.99% 4548.10 4548.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.09% 3.42 0 6 4258.88 4065 5095 4232.58 0 5095 14557 20793 29.86%
crit 22.91% 1.02 0 5 9600.34 9146 11464 6564.17 0 11464 9753 13931 20.52%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:4.47
  • if_expr:buff.dead_eye.down
Master Marksman 333 4.5% 195.3 1.54sec 513 0 Periodic 325.7 308 0 308 0.0% 72.2%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 195.34 0.00 325.71 325.71 0.0000 2.0000 100171.04 100171.04 0.00% 153.77 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 325.71 231 434 307.54 37 2621 307.49 222 403 100171 100171 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 1639 22.2% 81.5 3.69sec 6048 5297 Direct 243.9 1647 3289 2021 22.8%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 81.51 243.90 0.00 0.00 1.1418 0.0000 492983.86 704178.15 29.99% 5297.26 5297.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.21% 188.31 131 238 1646.63 953 2194 1646.40 1542 1735 310113 442965 29.99%
crit 22.79% 55.59 28 86 3289.38 1905 4389 3289.08 2870 3551 182871 261213 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:76.56
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:4.94
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 765 10.4% 17.5 17.24sec 13158 7470 Periodic 380.7 493 985 605 22.7% 2.9%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.49 0.00 127.38 380.66 1.7615 0.2072 230129.68 328717.23 29.99% 7469.80 7469.80
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.34% 294.39 160 433 493.17 351 925 493.03 472 512 145185 207382 29.99%
crit 22.66% 86.27 44 143 984.57 703 1850 984.50 871 1093 84945 121335 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:17.49
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 43 0.6% 43.5 6.84sec 301 0 Direct 43.5 245 491 301 22.6%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.50 43.50 0.00 0.00 0.0000 0.0000 13086.01 13086.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.43% 33.68 17 53 245.40 239 266 245.43 241 250 8266 8266 0.00%
crit 22.57% 9.82 1 25 490.90 479 533 490.82 479 512 4820 4820 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 337 4.6% 64.5 4.63sec 1575 1169 Direct 65.4 1266 2534 1553 22.7%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.46 65.35 0.00 0.00 1.3475 0.0000 101520.57 145011.98 29.99% 1168.84 1168.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.34% 50.54 30 70 1266.07 1219 1605 1265.91 1238 1297 63996 91412 29.99%
crit 22.66% 14.81 4 30 2534.36 2439 3210 2533.82 2439 2687 37524 53600 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.69
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:48.02
Wild Spirits 29 (789) 0.4% (10.6%) 3.0 120.57sec 79180 72086 Direct 8.9 (135.2) 776 1555 955 22.9% (22.8%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 8.92 0.00 0.00 1.0985 0.0000 8512.09 8512.09 0.00% 72085.90 72085.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.06% 6.87 3 9 776.09 726 910 776.21 726 849 5332 5332 0.00%
crit 22.94% 2.05 0 6 1554.56 1452 1820 1399.88 0 1820 3180 3180 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 761 10.3% 42.1 6.11sec 5402 0 Direct 126.2 1467 2932 1801 22.8%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.08 126.25 0.00 0.00 0.0000 0.0000 227352.96 227352.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.23% 97.51 57 115 1467.14 1355 1699 1467.93 1438 1544 143056 143056 0.00%
crit 22.77% 28.74 12 43 2932.48 2711 3398 2934.23 2800 3155 84297 84297 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
call_ot_wild
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:call_ot_wild
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 2.7 151.30sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.69
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.64sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 0.00 0.00 0.00 0.9785 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.63
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:call_ot_wild
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:call_ot_wild
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 306.31sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.48
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 4.4 78.63sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.36 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:0.650
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:4.36

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 2.7 0.0 150.6sec 150.6sec 14.7sec 13.02% 0.00% 0.0 (0.0) 2.5

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 160.8s
  • trigger_min/max:120.0s / 160.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:13.02%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.5sec 60.6sec 4.1sec 7.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • double_tap_1:7.63%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.7 0.2 31.0sec 30.1sec 1.9sec 5.37% 17.03% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 233.1s
  • trigger_min/max:1.8s / 230.7s
  • trigger_pct:8.01%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • lock_and_load_1:5.37%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 306.4sec 306.4sec 23.2sec 11.18% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 318.6s
  • trigger_min/max:300.0s / 318.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.18%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.4 10.0 7.4sec 5.9sec 3.1sec 42.06% 85.81% 5.0 (5.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 39.8s
  • trigger_min/max:0.9s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.7s

Stack Uptimes

  • precise_shots_1:35.45%
  • precise_shots_2:6.61%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 6.6 17.5 49.0sec 12.6sec 42.6sec 92.98% 0.00% 17.5 (17.5) 5.7

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 256.4s
  • trigger_min/max:4.0s / 39.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 245.2s

Stack Uptimes

  • steady_focus_1:92.98%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 68.6 12.9 4.4sec 3.7sec 3.8sec 87.04% 100.00% 12.9 (12.9) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.3s
  • trigger_min/max:0.9s / 10.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:87.04%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 4.4 0.0 78.6sec 78.6sec 19.0sec 27.56% 0.00% 0.0 (0.0) 4.1

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 81.8s
  • trigger_min/max:78.0s / 81.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 19.7s

Stack Uptimes

  • trueshot_1:27.56%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.6sec 120.6sec 17.6sec 17.45% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.45%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.8 2.0 7.0 67.5s 47.1s 246.1s
double_tap_rapid_fire 0.8 0.0 4.0 108.3s 57.2s 303.2s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.88% 0.68% 1.94% 0.9s 0.0s 2.5s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7610.0012.7112.9290.0007.087
Aimed Shot1.4110.0016.98219.2097.67940.099
Kill Shot4.1030.00124.71313.2080.00030.788
Wild Spirits0.6930.0012.7141.1500.0004.125
Trueshot0.7420.0013.8122.0840.0006.585
Rapid Fire3.5620.00129.70453.93723.05793.432

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
call_ot_wild
steady_shot Focus 65.47 634.63 20.68% 9.69 20.05 3.06%
rapid_fire Focus 127.32 127.23 4.15% 1.00 0.09 0.07%
focus_regen Focus 616.59 1949.39 63.52% 3.16 19.52 0.99%
Trueshot Focus 238.53 357.47 11.65% 1.50 1.41 0.39%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 10.20 10.41 41.1 35.5 0.2 95.2
Usage Type Count Total Avg RPE APR
call_ot_wild
aimed_shot Focus 50.4 1458.6 29.0 29.0 585.4
kill_shot Focus 4.5 44.7 10.0 10.0 544.4
multishot Focus 81.5 1630.0 20.0 20.0 302.4

Statistics & Data Analysis

Fight Length
call_ot_wild Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
call_ot_wild Damage Per Second
Count 1323
Mean 7373.72
Minimum 6747.50
Maximum 8061.36
Spread ( max - min ) 1313.86
Range [ ( max - min ) / 2 * 100% ] 8.91%
Standard Deviation 198.5055
5th Percentile 7058.56
95th Percentile 7708.53
( 95th Percentile - 5th Percentile ) 649.96
Mean Distribution
Standard Deviation 5.4575
95.00% Confidence Interval ( 7363.03 - 7384.42 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2784
0.1 Scale Factor Error with Delta=300 337
0.05 Scale Factor Error with Delta=300 1346
0.01 Scale Factor Error with Delta=300 33638
Priority Target DPS
call_ot_wild Priority Target Damage Per Second
Count 1323
Mean 3768.28
Minimum 3418.74
Maximum 4221.23
Spread ( max - min ) 802.49
Range [ ( max - min ) / 2 * 100% ] 10.65%
Standard Deviation 122.8763
5th Percentile 3574.24
95th Percentile 3976.54
( 95th Percentile - 5th Percentile ) 402.29
Mean Distribution
Standard Deviation 3.3782
95.00% Confidence Interval ( 3761.66 - 3774.90 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4085
0.1 Scale Factor Error with Delta=300 129
0.05 Scale Factor Error with Delta=300 516
0.01 Scale Factor Error with Delta=300 12890
DPS(e)
call_ot_wild Damage Per Second (Effective)
Count 1323
Mean 7373.72
Minimum 6747.50
Maximum 8061.36
Spread ( max - min ) 1313.86
Range [ ( max - min ) / 2 * 100% ] 8.91%
Damage
call_ot_wild Damage
Count 1323
Mean 2216476.72
Minimum 1666088.07
Maximum 2692985.98
Spread ( max - min ) 1026897.90
Range [ ( max - min ) / 2 * 100% ] 23.17%
DTPS
call_ot_wild Damage Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
call_ot_wild Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
call_ot_wild Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
call_ot_wild Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
call_ot_wild Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
call_ot_wild Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
call_ot_wildTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
call_ot_wild Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.76 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.69 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.48 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.69 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.63 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 4.36 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 50.55 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 17.49 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 76.56 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 4.47 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 4.94 multishot,if=focus>cost+action.aimed_shot.cost
O 48.02 steady_shot

Sample Sequence

0125789FHIDELJLJLJLKLJLOFJLJOLKLJLOFLJLOLJLOKLJOFLLJLOOJGLLJLKLOFJLOOJLOONOJLIKLJLOFJL9JLKLOJLKLOFJLOGJLOFJLKHLONJLOFLJLOJLJLKLOFJLOLJLOIDJOFLJLKLJGLKLJLOF9JLKLJLOJLOFOLJLOKLJLJLOFLJLOOLJLKLJGLOFLIJLKLHJLKLJOFLJLKLOJLOFJLO9MOJLKLOFJLMLJOGLOFLJLKLMOFJLJLJELIDMOFJLJLKLMOFJLJLKL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask call_ot_wild 100.0/100: 100% focus
Pre precombat 1 augmentation call_ot_wild 100.0/100: 100% focus
Pre precombat 2 food call_ot_wild 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.485 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.400 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.400 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.400 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.400 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.316 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.231 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.147 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.064 trickshots L multishot Fluffy_Pillow 69.5/100: 70% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.980 trickshots J aimed_shot Fluffy_Pillow 60.9/100: 61% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:07.898 trickshots L multishot Fluffy_Pillow 37.2/100: 37% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:08.814 trickshots K rapid_fire Fluffy_Pillow 28.5/100: 28% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.184 trickshots L multishot Fluffy_Pillow 55.4/100: 55% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.101 trickshots J aimed_shot Fluffy_Pillow 46.7/100: 47% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.016 trickshots L multishot Fluffy_Pillow 23.0/100: 23% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:12.931 trickshots O steady_shot Fluffy_Pillow 14.3/100: 14% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:13.999 trickshots F steady_shot Fluffy_Pillow 42.5/100: 42% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:15.065 trickshots J aimed_shot Fluffy_Pillow 70.6/100: 71% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:15.981 trickshots L multishot Fluffy_Pillow 46.9/100: 47% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:16.896 trickshots J aimed_shot Fluffy_Pillow 38.2/100: 38% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:17.811 trickshots O steady_shot Fluffy_Pillow 14.5/100: 15% focus bloodlust, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:18.878 trickshots L multishot Fluffy_Pillow 42.7/100: 43% focus bloodlust, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:19.795 trickshots K rapid_fire Fluffy_Pillow 34.0/100: 34% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:21.315 trickshots L multishot Fluffy_Pillow 62.8/100: 63% focus bloodlust, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:22.229 trickshots J aimed_shot Fluffy_Pillow 53.3/100: 53% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:23.752 trickshots L multishot Fluffy_Pillow 30.9/100: 31% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:24.669 trickshots O steady_shot Fluffy_Pillow 18.4/100: 18% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:25.733 trickshots F steady_shot Fluffy_Pillow 37.2/100: 37% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:26.803 trickshots L multishot Fluffy_Pillow 56.0/100: 56% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:27.720 trickshots J aimed_shot Fluffy_Pillow 43.5/100: 43% focus bloodlust, steady_focus, trick_shots
0:29.243 trickshots L multishot Fluffy_Pillow 21.0/100: 21% focus bloodlust, lock_and_load, precise_shots(2), steady_focus
0:30.158 trickshots O steady_shot Fluffy_Pillow 8.6/100: 9% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:31.224 trickshots L multishot Fluffy_Pillow 27.3/100: 27% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:32.139 trickshots J aimed_shot Fluffy_Pillow 14.9/100: 15% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:33.055 trickshots L multishot Fluffy_Pillow 22.4/100: 22% focus bloodlust, precise_shots, steady_focus
0:33.968 trickshots O steady_shot Fluffy_Pillow 9.9/100: 10% focus bloodlust, steady_focus, trick_shots
0:35.035 trickshots K rapid_fire Fluffy_Pillow 28.7/100: 29% focus bloodlust, steady_focus, trick_shots
0:36.475 trickshots L multishot Fluffy_Pillow 47.5/100: 48% focus bloodlust, steady_focus
0:37.390 trickshots J aimed_shot Fluffy_Pillow 35.1/100: 35% focus bloodlust, steady_focus, trick_shots
0:38.912 trickshots O steady_shot Fluffy_Pillow 12.6/100: 13% focus bloodlust, lock_and_load, precise_shots(2), steady_focus
0:39.977 trickshots F steady_shot Fluffy_Pillow 31.3/100: 31% focus bloodlust, lock_and_load, precise_shots(2), steady_focus
0:41.045 trickshots L multishot Fluffy_Pillow 50.1/100: 50% focus lock_and_load, precise_shots(2), steady_focus
0:42.235 trickshots L multishot Fluffy_Pillow 37.6/100: 38% focus lock_and_load, precise_shots, steady_focus, trick_shots
0:43.424 trickshots J aimed_shot Fluffy_Pillow 25.1/100: 25% focus lock_and_load, steady_focus, trick_shots
0:44.613 trickshots L multishot Fluffy_Pillow 32.6/100: 33% focus precise_shots(2), steady_focus
0:45.801 trickshots O steady_shot Fluffy_Pillow 20.2/100: 20% focus precise_shots, steady_focus, trick_shots
0:47.187 trickshots O steady_shot Fluffy_Pillow 38.9/100: 39% focus precise_shots, steady_focus, trick_shots
0:48.575 trickshots J aimed_shot Fluffy_Pillow 57.7/100: 58% focus lock_and_load, precise_shots, steady_focus, trick_shots
0:49.765 trickshots G double_tap Fluffy_Pillow 65.2/100: 65% focus precise_shots(2), steady_focus
0:51.190 trickshots L multishot Fluffy_Pillow 74.3/100: 74% focus double_tap, precise_shots(2), steady_focus
0:52.378 trickshots L multishot Fluffy_Pillow 61.8/100: 62% focus double_tap, precise_shots, steady_focus, trick_shots
0:53.567 trickshots J aimed_shot Fluffy_Pillow 49.3/100: 49% focus double_tap, steady_focus, trick_shots
0:55.545 trickshots L multishot Fluffy_Pillow 26.8/100: 27% focus precise_shots, steady_focus
0:56.733 trickshots K rapid_fire Fluffy_Pillow 14.3/100: 14% focus steady_focus, trick_shots
0:58.505 trickshots L multishot Fluffy_Pillow 32.6/100: 33% focus steady_focus
0:59.693 trickshots O steady_shot Fluffy_Pillow 20.1/100: 20% focus steady_focus, trick_shots
1:01.079 trickshots F steady_shot Fluffy_Pillow 38.9/100: 39% focus steady_focus, trick_shots
1:02.466 trickshots J aimed_shot Fluffy_Pillow 57.6/100: 58% focus steady_focus, trick_shots
1:04.445 trickshots L multishot Fluffy_Pillow 35.2/100: 35% focus precise_shots, steady_focus
1:05.632 trickshots O steady_shot Fluffy_Pillow 22.7/100: 23% focus steady_focus, trick_shots
1:07.017 trickshots O steady_shot Fluffy_Pillow 41.4/100: 41% focus steady_focus, trick_shots
1:08.403 trickshots J aimed_shot Fluffy_Pillow 60.2/100: 60% focus steady_focus, trick_shots
1:10.382 trickshots L multishot Fluffy_Pillow 37.7/100: 38% focus precise_shots, steady_focus
1:11.571 trickshots O steady_shot Fluffy_Pillow 25.3/100: 25% focus steady_focus, trick_shots
1:12.957 trickshots O steady_shot Fluffy_Pillow 44.0/100: 44% focus steady_focus, trick_shots
1:14.343 trickshots N multishot Fluffy_Pillow 62.8/100: 63% focus steady_focus, trick_shots
1:15.533 trickshots O steady_shot Fluffy_Pillow 50.3/100: 50% focus steady_focus, trick_shots
1:16.921 trickshots J aimed_shot Fluffy_Pillow 69.1/100: 69% focus steady_focus, trick_shots
1:18.992 trickshots L multishot Fluffy_Pillow 47.2/100: 47% focus precise_shots(2), steady_focus
1:20.180 trickshots I trueshot Fluffy_Pillow 34.7/100: 35% focus precise_shots, steady_focus, trick_shots
1:20.399 trickshots K rapid_fire Fluffy_Pillow 36.1/100: 36% focus precise_shots, steady_focus, trick_shots, trueshot
1:22.119 trickshots L multishot Fluffy_Pillow 61.5/100: 61% focus precise_shots, steady_focus, trueshot
1:23.309 trickshots J aimed_shot Fluffy_Pillow 52.8/100: 53% focus steady_focus, trick_shots, trueshot
1:24.498 trickshots L multishot Fluffy_Pillow 29.0/100: 29% focus precise_shots(2), steady_focus, trueshot
1:25.686 trickshots O steady_shot Fluffy_Pillow 20.3/100: 20% focus precise_shots, steady_focus, trick_shots, trueshot
1:27.071 trickshots F steady_shot Fluffy_Pillow 48.5/100: 48% focus precise_shots, steady_focus, trick_shots, trueshot
1:28.459 trickshots J aimed_shot Fluffy_Pillow 76.7/100: 77% focus precise_shots, steady_focus, trick_shots, trueshot
1:29.648 trickshots L multishot Fluffy_Pillow 52.9/100: 53% focus precise_shots(2), steady_focus, trueshot
1:30.837 default 9 use_items Fluffy_Pillow 44.2/100: 44% focus precise_shots, steady_focus, trick_shots, trueshot
1:30.837 trickshots J aimed_shot Fluffy_Pillow 44.2/100: 44% focus precise_shots, steady_focus, trick_shots, trueshot
1:32.026 trickshots L multishot Fluffy_Pillow 20.5/100: 21% focus precise_shots(2), steady_focus, trueshot
1:33.215 trickshots K rapid_fire Fluffy_Pillow 11.8/100: 12% focus precise_shots, steady_focus, trick_shots, trueshot
1:34.897 trickshots L multishot Fluffy_Pillow 37.8/100: 38% focus precise_shots, steady_focus, trueshot
1:36.086 trickshots O steady_shot Fluffy_Pillow 29.1/100: 29% focus steady_focus, trick_shots, trueshot
1:37.472 trickshots J aimed_shot Fluffy_Pillow 57.2/100: 57% focus steady_focus, trick_shots, trueshot
1:38.661 trickshots L multishot Fluffy_Pillow 33.5/100: 34% focus precise_shots, steady_focus, trueshot
1:39.850 trickshots K rapid_fire Fluffy_Pillow 24.8/100: 25% focus steady_focus, trick_shots, trueshot
1:41.591 trickshots L multishot Fluffy_Pillow 44.4/100: 44% focus steady_focus
1:42.780 trickshots O steady_shot Fluffy_Pillow 32.0/100: 32% focus steady_focus, trick_shots
1:44.165 trickshots F steady_shot Fluffy_Pillow 50.4/100: 50% focus trick_shots
1:45.650 trickshots J aimed_shot Fluffy_Pillow 69.2/100: 69% focus steady_focus, trick_shots
1:47.628 trickshots L multishot Fluffy_Pillow 46.7/100: 47% focus precise_shots, steady_focus
1:48.815 trickshots O steady_shot Fluffy_Pillow 34.3/100: 34% focus steady_focus, trick_shots
1:50.202 trickshots G double_tap Fluffy_Pillow 53.0/100: 53% focus steady_focus, trick_shots
1:51.389 trickshots J aimed_shot Fluffy_Pillow 60.6/100: 61% focus double_tap, steady_focus, trick_shots
1:53.367 trickshots L multishot Fluffy_Pillow 38.1/100: 38% focus precise_shots, steady_focus
1:54.556 trickshots O steady_shot Fluffy_Pillow 25.6/100: 26% focus steady_focus, trick_shots
1:55.943 trickshots F steady_shot Fluffy_Pillow 44.4/100: 44% focus steady_focus, trick_shots
1:57.330 trickshots J aimed_shot Fluffy_Pillow 63.2/100: 63% focus steady_focus, trick_shots
1:59.308 trickshots L multishot Fluffy_Pillow 40.7/100: 41% focus precise_shots, steady_focus
2:00.498 trickshots K rapid_fire Fluffy_Pillow 28.2/100: 28% focus steady_focus, trick_shots
2:02.203 trickshots H wild_spirits Fluffy_Pillow 46.0/100: 46% focus steady_focus
2:03.391 trickshots L multishot Fluffy_Pillow 53.5/100: 54% focus steady_focus
2:04.580 trickshots O steady_shot Fluffy_Pillow 41.0/100: 41% focus steady_focus, trick_shots, wild_spirits
2:05.966 trickshots N multishot Fluffy_Pillow 59.8/100: 60% focus steady_focus, trick_shots, wild_spirits
2:07.153 trickshots J aimed_shot Fluffy_Pillow 47.3/100: 47% focus steady_focus, trick_shots, wild_spirits
2:09.132 trickshots L multishot Fluffy_Pillow 24.9/100: 25% focus precise_shots(2), steady_focus, wild_spirits
2:10.320 trickshots O steady_shot Fluffy_Pillow 12.4/100: 12% focus precise_shots, steady_focus, trick_shots, wild_spirits
2:11.705 trickshots F steady_shot Fluffy_Pillow 31.1/100: 31% focus precise_shots, steady_focus, trick_shots, wild_spirits
2:13.091 trickshots L multishot Fluffy_Pillow 49.6/100: 50% focus lock_and_load, precise_shots, steady_focus, trick_shots, wild_spirits
2:14.280 trickshots J aimed_shot Fluffy_Pillow 37.1/100: 37% focus lock_and_load, steady_focus, trick_shots, wild_spirits
2:15.469 trickshots L multishot Fluffy_Pillow 44.6/100: 45% focus precise_shots, steady_focus, wild_spirits
2:16.656 trickshots O steady_shot Fluffy_Pillow 32.2/100: 32% focus steady_focus, trick_shots, wild_spirits
2:18.040 trickshots J aimed_shot Fluffy_Pillow 50.9/100: 51% focus lock_and_load, steady_focus, trick_shots, wild_spirits
2:19.229 trickshots L multishot Fluffy_Pillow 58.4/100: 58% focus precise_shots, steady_focus, wild_spirits
2:20.417 trickshots J aimed_shot Fluffy_Pillow 46.0/100: 46% focus steady_focus, trick_shots, wild_spirits
2:22.394 trickshots L multishot Fluffy_Pillow 23.5/100: 23% focus precise_shots(2), steady_focus
2:23.581 trickshots K rapid_fire Fluffy_Pillow 11.0/100: 11% focus precise_shots, steady_focus, trick_shots
2:25.430 trickshots L multishot Fluffy_Pillow 29.7/100: 30% focus precise_shots, steady_focus
2:26.619 trickshots O steady_shot Fluffy_Pillow 17.2/100: 17% focus steady_focus, trick_shots
2:28.006 trickshots F steady_shot Fluffy_Pillow 36.0/100: 36% focus steady_focus, trick_shots
2:29.393 trickshots J aimed_shot Fluffy_Pillow 54.2/100: 54% focus steady_focus, trick_shots
2:31.370 trickshots L multishot Fluffy_Pillow 31.7/100: 32% focus precise_shots(2), steady_focus
2:32.560 trickshots O steady_shot Fluffy_Pillow 19.3/100: 19% focus precise_shots, steady_focus, trick_shots
2:33.946 trickshots L multishot Fluffy_Pillow 38.0/100: 38% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:35.133 trickshots J aimed_shot Fluffy_Pillow 25.6/100: 26% focus lock_and_load, steady_focus, trick_shots
2:36.321 trickshots L multishot Fluffy_Pillow 33.1/100: 33% focus precise_shots(2), steady_focus
2:37.510 trickshots O steady_shot Fluffy_Pillow 20.6/100: 21% focus precise_shots, steady_focus, trick_shots
2:38.898 trickshots I trueshot Fluffy_Pillow 39.4/100: 39% focus precise_shots, steady_focus, trick_shots
2:38.898 cds D blood_fury Fluffy_Pillow 39.4/100: 39% focus precise_shots, steady_focus, trick_shots, trueshot
2:38.898 trickshots J aimed_shot Fluffy_Pillow 39.4/100: 39% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:40.087 trickshots O steady_shot Fluffy_Pillow 15.7/100: 16% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:41.472 trickshots F steady_shot Fluffy_Pillow 43.8/100: 44% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:42.859 trickshots L multishot Fluffy_Pillow 72.0/100: 72% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:44.047 trickshots J aimed_shot Fluffy_Pillow 63.3/100: 63% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:45.235 trickshots L multishot Fluffy_Pillow 39.6/100: 40% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:46.424 trickshots K rapid_fire Fluffy_Pillow 30.8/100: 31% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:48.267 trickshots L multishot Fluffy_Pillow 58.3/100: 58% focus blood_fury, precise_shots, steady_focus, trueshot
2:49.455 trickshots J aimed_shot Fluffy_Pillow 49.6/100: 50% focus blood_fury, steady_focus, trick_shots, trueshot
2:50.644 trickshots G double_tap Fluffy_Pillow 25.9/100: 26% focus blood_fury, precise_shots, steady_focus, trueshot
2:51.831 trickshots L multishot Fluffy_Pillow 37.2/100: 37% focus blood_fury, double_tap, precise_shots, steady_focus, trueshot
2:53.021 trickshots K rapid_fire Fluffy_Pillow 28.5/100: 28% focus blood_fury, double_tap, steady_focus, trick_shots, trueshot
2:54.898 trickshots L multishot Fluffy_Pillow 66.3/100: 66% focus steady_focus, trueshot
2:56.085 trickshots J aimed_shot Fluffy_Pillow 57.6/100: 58% focus steady_focus, trick_shots, trueshot
2:57.275 trickshots L multishot Fluffy_Pillow 33.9/100: 34% focus precise_shots, steady_focus, trueshot
2:58.462 trickshots O steady_shot Fluffy_Pillow 24.8/100: 25% focus trick_shots, trueshot
2:59.944 trickshots F steady_shot Fluffy_Pillow 43.8/100: 44% focus trick_shots
3:01.426 default 9 use_items Fluffy_Pillow 62.5/100: 63% focus steady_focus, trick_shots
3:01.426 trickshots J aimed_shot Fluffy_Pillow 62.5/100: 63% focus steady_focus, trick_shots
3:03.405 trickshots L multishot Fluffy_Pillow 40.1/100: 40% focus precise_shots, steady_focus
3:04.594 trickshots K rapid_fire Fluffy_Pillow 27.6/100: 28% focus steady_focus, trick_shots
3:06.364 trickshots L multishot Fluffy_Pillow 45.8/100: 46% focus lock_and_load, steady_focus
3:07.552 trickshots J aimed_shot Fluffy_Pillow 33.3/100: 33% focus lock_and_load, steady_focus, trick_shots
3:08.740 trickshots L multishot Fluffy_Pillow 40.8/100: 41% focus precise_shots, steady_focus
3:09.928 trickshots O steady_shot Fluffy_Pillow 28.3/100: 28% focus steady_focus, trick_shots
3:11.314 trickshots J aimed_shot Fluffy_Pillow 47.1/100: 47% focus steady_focus, trick_shots
3:13.291 trickshots L multishot Fluffy_Pillow 24.6/100: 25% focus precise_shots(2), steady_focus
3:14.479 trickshots O steady_shot Fluffy_Pillow 12.2/100: 12% focus precise_shots, steady_focus, trick_shots
3:15.868 trickshots F steady_shot Fluffy_Pillow 30.9/100: 31% focus precise_shots, steady_focus, trick_shots
3:17.254 trickshots O steady_shot Fluffy_Pillow 49.4/100: 49% focus precise_shots, steady_focus, trick_shots
3:18.642 trickshots L multishot Fluffy_Pillow 68.2/100: 68% focus precise_shots, steady_focus, trick_shots
3:19.831 trickshots J aimed_shot Fluffy_Pillow 55.7/100: 56% focus steady_focus, trick_shots
3:21.809 trickshots L multishot Fluffy_Pillow 33.2/100: 33% focus precise_shots(2), steady_focus
3:22.998 trickshots O steady_shot Fluffy_Pillow 20.7/100: 21% focus precise_shots, steady_focus, trick_shots
3:24.384 trickshots K rapid_fire Fluffy_Pillow 39.5/100: 40% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:26.383 trickshots L multishot Fluffy_Pillow 59.2/100: 59% focus lock_and_load, precise_shots, steady_focus
3:27.572 trickshots J aimed_shot Fluffy_Pillow 46.7/100: 47% focus lock_and_load, steady_focus, trick_shots
3:28.762 trickshots L multishot Fluffy_Pillow 54.2/100: 54% focus precise_shots(2), steady_focus
3:29.950 trickshots J aimed_shot Fluffy_Pillow 41.7/100: 42% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:31.136 trickshots L multishot Fluffy_Pillow 49.2/100: 49% focus precise_shots(2), steady_focus
3:32.325 trickshots O steady_shot Fluffy_Pillow 36.7/100: 37% focus precise_shots, trick_shots
3:33.808 trickshots F steady_shot Fluffy_Pillow 55.5/100: 56% focus precise_shots, trick_shots
3:35.292 trickshots L multishot Fluffy_Pillow 74.3/100: 74% focus precise_shots, steady_focus, trick_shots
3:36.480 trickshots J aimed_shot Fluffy_Pillow 61.8/100: 62% focus steady_focus, trick_shots
3:38.458 trickshots L multishot Fluffy_Pillow 39.3/100: 39% focus precise_shots(2), steady_focus
3:39.648 trickshots O steady_shot Fluffy_Pillow 26.9/100: 27% focus precise_shots, steady_focus, trick_shots
3:41.033 trickshots O steady_shot Fluffy_Pillow 45.6/100: 46% focus precise_shots, steady_focus, trick_shots
3:42.419 trickshots L multishot Fluffy_Pillow 64.4/100: 64% focus precise_shots, steady_focus, trick_shots
3:43.606 trickshots J aimed_shot Fluffy_Pillow 51.9/100: 52% focus lock_and_load, steady_focus, trick_shots
3:44.795 trickshots L multishot Fluffy_Pillow 59.4/100: 59% focus precise_shots(2), steady_focus
3:45.985 trickshots K rapid_fire Fluffy_Pillow 47.0/100: 47% focus precise_shots, steady_focus, trick_shots
3:47.785 trickshots L multishot Fluffy_Pillow 65.4/100: 65% focus precise_shots, steady_focus
3:48.973 trickshots J aimed_shot Fluffy_Pillow 52.9/100: 53% focus steady_focus, trick_shots
3:50.952 trickshots G double_tap Fluffy_Pillow 30.4/100: 30% focus precise_shots(2), steady_focus
3:52.141 trickshots L multishot Fluffy_Pillow 37.9/100: 38% focus double_tap, precise_shots(2), steady_focus
3:53.329 trickshots O steady_shot Fluffy_Pillow 25.4/100: 25% focus double_tap, precise_shots, steady_focus, trick_shots
3:54.715 trickshots F steady_shot Fluffy_Pillow 44.2/100: 44% focus double_tap, precise_shots, steady_focus, trick_shots
3:56.102 trickshots L multishot Fluffy_Pillow 63.0/100: 63% focus double_tap, precise_shots, steady_focus, trick_shots
3:57.290 trickshots I trueshot Fluffy_Pillow 50.5/100: 51% focus double_tap, steady_focus, trick_shots
3:57.290 trickshots J aimed_shot Fluffy_Pillow 50.5/100: 51% focus double_tap, steady_focus, trick_shots, trueshot
3:58.479 trickshots L multishot Fluffy_Pillow 26.8/100: 27% focus precise_shots, steady_focus, trueshot
3:59.665 trickshots K rapid_fire Fluffy_Pillow 18.1/100: 18% focus steady_focus, trick_shots, trueshot
4:01.601 trickshots L multishot Fluffy_Pillow 46.4/100: 46% focus steady_focus, trueshot
4:02.789 trickshots H wild_spirits Fluffy_Pillow 37.7/100: 38% focus steady_focus, trick_shots, trueshot
4:03.978 trickshots J aimed_shot Fluffy_Pillow 49.0/100: 49% focus steady_focus, trick_shots, trueshot
4:05.167 trickshots L multishot Fluffy_Pillow 25.3/100: 25% focus precise_shots, steady_focus, trueshot, wild_spirits
4:06.356 trickshots K rapid_fire Fluffy_Pillow 16.6/100: 17% focus steady_focus, trick_shots, trueshot, wild_spirits
4:08.169 trickshots L multishot Fluffy_Pillow 43.8/100: 44% focus steady_focus, trueshot, wild_spirits
4:09.357 trickshots J aimed_shot Fluffy_Pillow 35.1/100: 35% focus steady_focus, trick_shots, trueshot, wild_spirits
4:10.547 trickshots O steady_shot Fluffy_Pillow 11.4/100: 11% focus precise_shots, steady_focus, trueshot, wild_spirits
4:11.932 trickshots F steady_shot Fluffy_Pillow 39.0/100: 39% focus precise_shots, trueshot, wild_spirits
4:13.417 trickshots L multishot Fluffy_Pillow 67.2/100: 67% focus precise_shots, steady_focus, trueshot, wild_spirits
4:14.606 trickshots J aimed_shot Fluffy_Pillow 58.5/100: 58% focus steady_focus, trick_shots, trueshot, wild_spirits
4:15.793 trickshots L multishot Fluffy_Pillow 34.7/100: 35% focus precise_shots, steady_focus, trueshot, wild_spirits
4:16.980 trickshots K rapid_fire Fluffy_Pillow 25.9/100: 26% focus steady_focus, trick_shots, wild_spirits
4:18.839 trickshots L multishot Fluffy_Pillow 44.6/100: 45% focus steady_focus, wild_spirits
4:20.028 trickshots O steady_shot Fluffy_Pillow 32.2/100: 32% focus steady_focus, trick_shots, wild_spirits
4:21.413 trickshots J aimed_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus, trick_shots, wild_spirits
4:23.391 trickshots L multishot Fluffy_Pillow 28.5/100: 28% focus precise_shots, steady_focus
4:24.580 trickshots O steady_shot Fluffy_Pillow 16.0/100: 16% focus steady_focus, trick_shots
4:25.967 trickshots F steady_shot Fluffy_Pillow 34.8/100: 35% focus steady_focus, trick_shots
4:27.354 trickshots J aimed_shot Fluffy_Pillow 53.5/100: 54% focus steady_focus, trick_shots
4:29.332 trickshots L multishot Fluffy_Pillow 31.1/100: 31% focus precise_shots, steady_focus
4:30.520 trickshots O steady_shot Fluffy_Pillow 18.6/100: 19% focus steady_focus, trick_shots
4:31.907 default 9 use_items Fluffy_Pillow 37.4/100: 37% focus steady_focus, trick_shots
4:31.907 trickshots M kill_shot Fluffy_Pillow 37.4/100: 37% focus steady_focus, trick_shots
4:33.095 trickshots O steady_shot Fluffy_Pillow 34.9/100: 35% focus steady_focus, trick_shots
4:34.482 trickshots J aimed_shot Fluffy_Pillow 53.7/100: 54% focus steady_focus, trick_shots
4:36.458 trickshots L multishot Fluffy_Pillow 31.2/100: 31% focus precise_shots(2), steady_focus
4:37.647 trickshots K rapid_fire Fluffy_Pillow 18.7/100: 19% focus precise_shots, steady_focus, trick_shots
4:39.387 trickshots L multishot Fluffy_Pillow 36.7/100: 37% focus precise_shots, steady_focus
4:40.575 trickshots O steady_shot Fluffy_Pillow 24.2/100: 24% focus steady_focus, trick_shots
4:41.960 trickshots F steady_shot Fluffy_Pillow 43.0/100: 43% focus steady_focus, trick_shots
4:43.348 trickshots J aimed_shot Fluffy_Pillow 61.4/100: 61% focus steady_focus, trick_shots
4:45.325 trickshots L multishot Fluffy_Pillow 38.9/100: 39% focus precise_shots(2), steady_focus
4:46.514 trickshots M kill_shot Fluffy_Pillow 26.4/100: 26% focus precise_shots, steady_focus, trick_shots
4:47.703 trickshots L multishot Fluffy_Pillow 23.9/100: 24% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:48.892 trickshots J aimed_shot Fluffy_Pillow 11.5/100: 11% focus lock_and_load, steady_focus, trick_shots
4:50.079 trickshots O steady_shot Fluffy_Pillow 19.0/100: 19% focus precise_shots(2), steady_focus
4:51.465 trickshots G double_tap Fluffy_Pillow 37.7/100: 38% focus precise_shots(2), steady_focus
4:52.654 trickshots L multishot Fluffy_Pillow 45.3/100: 45% focus double_tap, precise_shots(2), steady_focus
4:53.844 trickshots O steady_shot Fluffy_Pillow 32.8/100: 33% focus double_tap, precise_shots, steady_focus, trick_shots
4:55.230 trickshots F steady_shot Fluffy_Pillow 51.6/100: 52% focus double_tap, precise_shots, steady_focus, trick_shots
4:56.615 trickshots L multishot Fluffy_Pillow 70.3/100: 70% focus double_tap, precise_shots, steady_focus, trick_shots
4:57.804 trickshots J aimed_shot Fluffy_Pillow 57.9/100: 58% focus double_tap, steady_focus, trick_shots
4:59.782 trickshots L multishot Fluffy_Pillow 35.4/100: 35% focus precise_shots, steady_focus
5:00.970 trickshots K rapid_fire Fluffy_Pillow 22.9/100: 23% focus steady_focus, trick_shots
5:02.867 trickshots L multishot Fluffy_Pillow 41.9/100: 42% focus steady_focus
5:04.055 trickshots M kill_shot Fluffy_Pillow 29.4/100: 29% focus steady_focus, trick_shots
5:05.242 trickshots O steady_shot Fluffy_Pillow 26.9/100: 27% focus steady_focus, trick_shots
5:06.630 trickshots F steady_shot Fluffy_Pillow 45.7/100: 46% focus lock_and_load, steady_focus, trick_shots
5:08.017 trickshots J aimed_shot Fluffy_Pillow 64.5/100: 64% focus lock_and_load, steady_focus, trick_shots
5:09.204 trickshots L multishot Fluffy_Pillow 72.0/100: 72% focus precise_shots, steady_focus
5:10.393 trickshots J aimed_shot Fluffy_Pillow 59.5/100: 60% focus lock_and_load, steady_focus, trick_shots
5:11.580 trickshots L multishot Fluffy_Pillow 67.0/100: 67% focus precise_shots, steady_focus
5:12.770 trickshots J aimed_shot Fluffy_Pillow 54.6/100: 55% focus steady_focus, trick_shots
5:14.748 cds E potion Fluffy_Pillow 32.1/100: 32% focus precise_shots(2), steady_focus
5:14.748 trickshots L multishot Fluffy_Pillow 32.1/100: 32% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:15.938 trickshots I trueshot Fluffy_Pillow 19.6/100: 20% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:15.938 cds D blood_fury Fluffy_Pillow 19.6/100: 20% focus precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:15.938 trickshots M kill_shot Fluffy_Pillow 19.6/100: 20% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:17.127 trickshots O steady_shot Fluffy_Pillow 20.9/100: 21% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:18.512 trickshots F steady_shot Fluffy_Pillow 49.1/100: 49% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:19.900 trickshots J aimed_shot Fluffy_Pillow 77.2/100: 77% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:21.090 trickshots L multishot Fluffy_Pillow 53.5/100: 54% focus blood_fury, precise_shots(2), steady_focus, trueshot, potion_of_spectral_agility
5:22.279 trickshots J aimed_shot Fluffy_Pillow 44.8/100: 45% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:23.468 trickshots L multishot Fluffy_Pillow 21.1/100: 21% focus blood_fury, precise_shots(2), steady_focus, trueshot, potion_of_spectral_agility
5:24.656 trickshots K rapid_fire Fluffy_Pillow 12.4/100: 12% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:26.478 trickshots L multishot Fluffy_Pillow 38.7/100: 39% focus blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
5:27.667 trickshots M kill_shot Fluffy_Pillow 30.0/100: 30% focus blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:28.855 trickshots O steady_shot Fluffy_Pillow 31.3/100: 31% focus blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:30.242 trickshots F steady_shot Fluffy_Pillow 59.4/100: 59% focus blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:31.627 trickshots J aimed_shot Fluffy_Pillow 87.6/100: 88% focus steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:32.815 trickshots L multishot Fluffy_Pillow 63.9/100: 64% focus precise_shots, steady_focus, trueshot, potion_of_spectral_agility
5:34.004 trickshots J aimed_shot Fluffy_Pillow 55.1/100: 55% focus steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:35.191 trickshots L multishot Fluffy_Pillow 31.4/100: 31% focus precise_shots(2), steady_focus, trueshot, potion_of_spectral_agility
5:36.380 trickshots K rapid_fire Fluffy_Pillow 20.2/100: 20% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:38.121 trickshots L multishot Fluffy_Pillow 38.2/100: 38% focus precise_shots, steady_focus, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Call of the Wild }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="call_ot_wild"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7003,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

eagle_true_focus : 7672 dps, 3841 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
7671.7 7671.7 14.7 / 0.192% 1030.6 / 13.4% 816.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.4 9.2 Focus 0.00% 47.4 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
eagle_true_focus 7672
Aimed Shot 2806 (3070) 36.6% (40.0%) 53.5 5.59sec 17224 11457 Direct 160.2 (175.1) 4286 8560 5256 22.7% (22.7%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 53.46 160.16 0.00 0.00 1.5033 0.0000 841856.64 1202508.02 29.99% 11457.08 11457.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.29% 123.79 84 163 4285.88 2524 9967 4289.21 3973 4617 530591 757896 29.99%
crit 22.71% 36.37 15 57 8559.55 5048 19934 8568.97 6481 11059 311266 444612 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:53.66
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 264 3.4% 0.0 0.00sec 0 0 Direct 14.9 4325 8564 5288 22.7%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 14.93 0.00 0.00 0.0000 0.0000 78914.45 112721.41 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.35% 11.55 3 18 4325.44 2524 9967 4351.82 3025 6137 49939 71333 29.99%
crit 22.65% 3.38 0 9 8564.38 5048 19934 8317.18 0 19934 28975 41389 29.04%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 372 4.9% 112.8 2.67sec 993 434 Direct 112.6 811 1622 994 22.6%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.80 112.59 0.00 0.00 2.2867 0.0000 111968.51 159935.82 29.99% 434.10 434.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.39% 87.14 60 114 810.99 774 1019 810.94 795 825 70673 100949 29.99%
crit 22.61% 25.45 10 45 1622.30 1548 2037 1622.25 1548 1708 41296 58987 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 139 1.8% 3.8 90.79sec 11101 0 Direct 3.7 9039 18070 11140 23.2%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.75 3.74 0.00 0.00 0.0000 0.0000 41643.48 41643.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.80% 2.87 0 4 9038.83 8937 9474 8982.79 0 9474 25963 25963 0.00%
crit 23.20% 0.87 0 4 18069.65 17875 18947 11115.52 0 18947 15681 15681 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 39 0.5% 21.8 13.26sec 546 0 Direct 21.8 446 892 546 22.5%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.75 21.75 0.00 0.00 0.0000 0.0000 11883.13 11883.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.49% 16.85 7 32 445.87 435 485 445.86 435 462 7515 7515 0.00%
crit 22.51% 4.90 0 14 892.08 871 969 885.60 0 969 4368 4368 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 71 0.9% 4.0 14.26sec 5402 4486 Direct 4.0 4211 9492 5443 23.3%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.99 3.96 0.00 0.00 1.2044 0.0000 21561.96 30799.10 29.99% 4485.53 4485.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.71% 3.04 0 7 4210.62 4065 4838 4153.78 0 4552 12800 18283 29.72%
crit 23.29% 0.92 0 4 9492.26 9146 10792 5889.22 0 10792 8762 12516 18.66%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:3.99
  • if_expr:buff.dead_eye.down
Master Marksman 344 4.5% 188.0 1.60sec 550 0 Periodic 323.1 320 0 320 0.0% 71.6%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 187.99 0.00 323.13 323.13 0.0000 2.0000 103327.58 103327.58 0.00% 159.88 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 323.13 228 419 319.79 37 2912 320.17 246 402 103328 103328 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 1785 23.3% 90.0 3.33sec 5955 5187 Direct 269.4 1624 3245 1990 22.6%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.04 269.45 0.00 0.00 1.1482 0.0000 536259.69 765993.34 29.99% 5186.97 5186.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.41% 208.58 149 262 1624.03 953 2194 1624.24 1515 1723 338712 483816 29.99%
crit 22.59% 60.87 33 88 3245.23 1905 4389 3245.65 2882 3533 197548 282177 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:79.29
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:10.75
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 651 8.5% 15.0 19.63sec 13051 7284 Periodic 324.9 491 984 603 22.7% 2.6%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.01 0.00 108.69 324.93 1.7917 0.2127 195880.98 279796.39 29.99% 7283.99 7283.99
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.27% 251.08 156 352 490.85 351 925 490.71 468 510 123244 176041 29.99%
crit 22.73% 73.84 40 115 983.62 703 1850 983.70 873 1134 72637 103755 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:15.01
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 43 0.6% 43.3 6.89sec 301 0 Direct 43.3 245 491 301 22.6%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.30 43.30 0.00 0.00 0.0000 0.0000 13022.53 13022.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.40% 33.52 17 54 245.32 239 266 245.33 241 251 8223 8223 0.00%
crit 22.60% 9.78 1 23 490.63 479 533 490.60 479 513 4800 4800 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 283 3.7% 55.2 5.39sec 1547 1128 Direct 56.1 1243 2485 1522 22.5%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.17 56.08 0.00 0.00 1.3713 0.0000 85380.42 121957.39 29.99% 1128.48 1128.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.49% 43.46 28 62 1242.67 1219 1451 1242.13 1221 1274 54009 77146 29.99%
crit 22.51% 12.63 3 24 2484.84 2439 2903 2483.83 2439 2596 31372 44812 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:13.15
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:42.24
Wild Spirits 30 (875) 0.4% (11.3%) 3.0 120.57sec 87676 79812 Direct 8.9 (145.2) 810 1619 992 22.5% (22.6%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 8.91 0.00 0.00 1.0985 0.0000 8844.77 8844.77 0.00% 79811.92 79811.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.49% 6.91 2 9 810.08 776 910 810.10 776 840 5595 5595 0.00%
crit 22.51% 2.01 0 7 1619.15 1552 1820 1456.34 0 1820 3250 3250 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 845 11.0% 45.4 5.66sec 5557 0 Direct 136.3 1510 3020 1852 22.6%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 45.43 136.30 0.00 0.00 0.0000 0.0000 252459.45 252459.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.35% 105.43 69 124 1510.38 1355 1699 1510.99 1487 1551 159247 159247 0.00%
crit 22.65% 30.87 12 49 3019.70 2711 3398 3020.84 2914 3145 93213 93213 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
eagle_true_focus
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:eagle_true_focus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.70sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.98
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.64sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 0.00 0.00 0.00 0.9786 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.63
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:eagle_true_focus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:eagle_true_focus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 308.91sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.48
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.71sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.7sec 120.7sec 14.7sec 14.64% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • blood_fury_1:14.64%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.5sec 60.6sec 4.8sec 8.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.4s

Stack Uptimes

  • double_tap_1:8.93%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Eagletalon's True Focus 3.0 0.0 120.7sec 120.7sec 19.1sec 19.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_eagletalons_true_focus
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.7s

Stack Uptimes

  • eagletalons_true_focus_1:19.01%

Spelldata

  • id:336851
  • name:Eagletalon's True Focus
  • tooltip:Focus cost of all abilities reduced by {$s1=50}%.
  • description:{$@spelldesc336849=Trueshot also reduces the Focus cost of all of your abilities by {$336851s1=50}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:336849
  • name:Eagletalon's True Focus
  • tooltip:
  • description:Trueshot also reduces the Focus cost of all of your abilities by {$336851s1=50}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.8 0.2 30.8sec 30.2sec 1.7sec 5.08% 16.13% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 237.9s
  • trigger_min/max:1.8s / 237.9s
  • trigger_pct:7.97%
  • duration_min/max:0.0s / 11.5s

Stack Uptimes

  • lock_and_load_1:5.08%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.0sec 309.0sec 23.1sec 11.18% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.9s
  • trigger_min/max:300.0s / 332.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.18%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 39.6 13.8 7.6sec 5.6sec 2.9sec 38.55% 80.85% 6.9 (6.9) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 40.5s
  • trigger_min/max:0.9s / 14.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 34.0s

Stack Uptimes

  • precise_shots_1:34.61%
  • precise_shots_2:3.94%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 7.1 13.6 44.7sec 14.7sec 34.0sec 79.95% 0.00% 13.6 (13.6) 6.3

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 130.4s
  • trigger_min/max:4.0s / 55.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 111.3s

Stack Uptimes

  • steady_focus_1:79.95%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 69.3 20.8 4.3sec 3.3sec 4.0sec 91.41% 100.00% 20.8 (20.8) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.5s
  • trigger_min/max:0.9s / 11.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.5s

Stack Uptimes

  • trick_shots_1:91.41%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.7sec 120.7sec 19.1sec 19.01% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.7s

Stack Uptimes

  • trueshot_1:19.01%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.6sec 120.6sec 17.6sec 17.46% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.46%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 5.0 2.0 7.0 64.0s 47.1s 245.2s
double_tap_rapid_fire 0.6 0.0 4.0 94.6s 58.8s 240.1s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 1.30% 0.88% 2.89% 0.8s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7880.0012.6993.1060.1268.740
Aimed Shot0.8150.0014.6722.7780.00012.584
Kill Shot5.0060.00139.02612.9140.00039.026
Wild Spirits0.7080.0012.7161.1520.0004.111
Trueshot0.7590.0012.9101.4220.2714.383
Rapid Fire3.3120.00127.42340.25213.11067.259

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
eagle_true_focus
steady_shot Focus 56.16 541.64 19.61% 9.64 20.00 3.56%
rapid_fire Focus 108.68 108.32 3.92% 1.00 0.37 0.34%
focus_regen Focus 598.13 1917.63 69.42% 3.21 33.09 1.70%
Trueshot Focus 173.02 194.81 7.05% 1.13 9.80 4.79%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.18 9.38 63.2 40.9 0.2 100.0
Usage Type Count Total Avg RPE APR
eagle_true_focus
aimed_shot Focus 53.5 1241.3 23.2 23.2 741.8
kill_shot Focus 4.0 39.7 10.0 9.9 543.7
multishot Focus 90.0 1540.6 17.1 17.1 348.1

Statistics & Data Analysis

Fight Length
eagle_true_focus Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
eagle_true_focus Damage Per Second
Count 1323
Mean 7671.68
Minimum 6850.55
Maximum 8497.84
Spread ( max - min ) 1647.29
Range [ ( max - min ) / 2 * 100% ] 10.74%
Standard Deviation 273.3049
5th Percentile 7236.39
95th Percentile 8122.74
( 95th Percentile - 5th Percentile ) 886.36
Mean Distribution
Standard Deviation 7.5139
95.00% Confidence Interval ( 7656.95 - 7686.40 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4876
0.1 Scale Factor Error with Delta=300 638
0.05 Scale Factor Error with Delta=300 2551
0.01 Scale Factor Error with Delta=300 63765
Priority Target DPS
eagle_true_focus Priority Target Damage Per Second
Count 1323
Mean 3841.07
Minimum 3466.16
Maximum 4310.38
Spread ( max - min ) 844.22
Range [ ( max - min ) / 2 * 100% ] 10.99%
Standard Deviation 143.9847
5th Percentile 3616.87
95th Percentile 4082.88
( 95th Percentile - 5th Percentile ) 466.01
Mean Distribution
Standard Deviation 3.9586
95.00% Confidence Interval ( 3833.31 - 3848.83 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5398
0.1 Scale Factor Error with Delta=300 177
0.05 Scale Factor Error with Delta=300 708
0.01 Scale Factor Error with Delta=300 17698
DPS(e)
eagle_true_focus Damage Per Second (Effective)
Count 1323
Mean 7671.68
Minimum 6850.55
Maximum 8497.84
Spread ( max - min ) 1647.29
Range [ ( max - min ) / 2 * 100% ] 10.74%
Damage
eagle_true_focus Damage
Count 1323
Mean 2303003.58
Minimum 1716524.97
Maximum 2789020.65
Spread ( max - min ) 1072495.68
Range [ ( max - min ) / 2 * 100% ] 23.28%
DTPS
eagle_true_focus Damage Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
eagle_true_focus Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
eagle_true_focus Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
eagle_true_focus Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
eagle_true_focus Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
eagle_true_focus Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
eagle_true_focusTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
eagle_true_focus Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.75 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.98 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.48 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 13.15 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.63 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 53.66 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 15.01 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 79.29 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 3.99 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 10.75 multishot,if=focus>cost+action.aimed_shot.cost
O 42.24 steady_shot

Sample Sequence

0125789FHIDELJLJLJLJLJLKLJLJLJLJLKLJLJLLJLJLOFOJLLJLKLJLOFGJLOOJLOKLOJLOFLNOJLJLOFKLJ9LONOFJLONONJLKLGOFJLOHIDNJLJLKLJLJLJLJLJLKLJLOFLJLOOOJLKLOONGJLOONN9JLOKLOFJLOLONJLOFKLJLOOLONJLJLOFKLJGLOOLNJHIDLKLJLJLJLJLJLJLJLKLOFJ9LMOJLOFOLKLJLMGOFJLOLMOJLKLOEFMJLOONNOJLKLMOFJLO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask eagle_true_focus 100.0/100: 100% focus
Pre precombat 1 augmentation eagle_true_focus 100.0/100: 100% focus
Pre precombat 2 food eagle_true_focus 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.485 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot, eagletalons_true_focus
0:02.401 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, eagletalons_true_focus
0:02.401 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, eagletalons_true_focus, potion_of_spectral_agility
0:03.315 trickshots J aimed_shot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:04.231 trickshots L multishot Fluffy_Pillow 83.9/100: 84% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:05.148 trickshots J aimed_shot Fluffy_Pillow 85.3/100: 85% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:06.062 trickshots L multishot Fluffy_Pillow 78.5/100: 79% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:06.977 trickshots J aimed_shot Fluffy_Pillow 79.8/100: 80% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:07.892 trickshots L multishot Fluffy_Pillow 73.1/100: 73% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:08.807 trickshots J aimed_shot Fluffy_Pillow 74.4/100: 74% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:09.722 trickshots L multishot Fluffy_Pillow 67.7/100: 68% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:10.637 trickshots J aimed_shot Fluffy_Pillow 69.0/100: 69% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:11.719 trickshots L multishot Fluffy_Pillow 64.4/100: 64% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:12.634 trickshots K rapid_fire Fluffy_Pillow 65.6/100: 66% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:14.151 trickshots L multishot Fluffy_Pillow 94.4/100: 94% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:15.067 trickshots J aimed_shot Fluffy_Pillow 95.7/100: 96% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:15.982 trickshots L multishot Fluffy_Pillow 83.9/100: 84% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:16.897 trickshots J aimed_shot Fluffy_Pillow 84.9/100: 85% focus bloodlust, blood_fury, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:17.878 trickshots L multishot Fluffy_Pillow 78.2/100: 78% focus bloodlust, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:18.857 trickshots J aimed_shot Fluffy_Pillow 79.5/100: 79% focus bloodlust, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:19.835 trickshots L multishot Fluffy_Pillow 72.8/100: 73% focus bloodlust, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:20.813 trickshots J aimed_shot Fluffy_Pillow 74.1/100: 74% focus bloodlust, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:21.793 trickshots L multishot Fluffy_Pillow 67.4/100: 67% focus bloodlust, precise_shots(2), trueshot, eagletalons_true_focus, potion_of_spectral_agility
0:22.772 trickshots K rapid_fire Fluffy_Pillow 65.9/100: 66% focus bloodlust, lock_and_load, precise_shots, trick_shots, potion_of_spectral_agility
0:24.209 trickshots L multishot Fluffy_Pillow 83.9/100: 84% focus bloodlust, lock_and_load, precise_shots, potion_of_spectral_agility
0:25.190 trickshots J aimed_shot Fluffy_Pillow 71.5/100: 71% focus bloodlust, lock_and_load, trick_shots, potion_of_spectral_agility
0:26.168 trickshots L multishot Fluffy_Pillow 79.0/100: 79% focus bloodlust, precise_shots(2), potion_of_spectral_agility
0:27.150 trickshots J aimed_shot Fluffy_Pillow 66.5/100: 67% focus bloodlust, lock_and_load, precise_shots, trick_shots, potion_of_spectral_agility
0:28.130 trickshots L multishot Fluffy_Pillow 74.1/100: 74% focus bloodlust, precise_shots(2)
0:29.109 trickshots L multishot Fluffy_Pillow 61.6/100: 62% focus bloodlust, precise_shots, trick_shots
0:30.090 trickshots J aimed_shot Fluffy_Pillow 49.1/100: 49% focus bloodlust, trick_shots
0:31.720 trickshots L multishot Fluffy_Pillow 26.7/100: 27% focus bloodlust, lock_and_load, precise_shots(2)
0:32.700 trickshots J aimed_shot Fluffy_Pillow 14.2/100: 14% focus bloodlust, lock_and_load, precise_shots, trick_shots
0:33.680 trickshots L multishot Fluffy_Pillow 21.8/100: 22% focus bloodlust, precise_shots(2)
0:34.661 trickshots O steady_shot Fluffy_Pillow 9.3/100: 9% focus bloodlust, precise_shots, trick_shots
0:35.803 trickshots F steady_shot Fluffy_Pillow 28.1/100: 28% focus bloodlust, precise_shots, trick_shots
0:36.945 trickshots O steady_shot Fluffy_Pillow 46.9/100: 47% focus bloodlust, precise_shots, steady_focus, trick_shots
0:38.012 trickshots J aimed_shot Fluffy_Pillow 65.6/100: 66% focus bloodlust, precise_shots, steady_focus, trick_shots
0:39.535 trickshots L multishot Fluffy_Pillow 43.2/100: 43% focus bloodlust, lock_and_load, precise_shots(2), steady_focus
0:40.451 trickshots L multishot Fluffy_Pillow 30.7/100: 31% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:41.366 trickshots J aimed_shot Fluffy_Pillow 17.5/100: 18% focus lock_and_load, steady_focus, trick_shots
0:42.556 trickshots L multishot Fluffy_Pillow 25.1/100: 25% focus lock_and_load, precise_shots(2), steady_focus
0:43.743 trickshots K rapid_fire Fluffy_Pillow 12.6/100: 13% focus lock_and_load, precise_shots, steady_focus, trick_shots
0:45.485 trickshots L multishot Fluffy_Pillow 30.6/100: 31% focus lock_and_load, precise_shots, steady_focus
0:46.673 trickshots J aimed_shot Fluffy_Pillow 18.1/100: 18% focus lock_and_load, steady_focus, trick_shots
0:47.861 trickshots L multishot Fluffy_Pillow 25.7/100: 26% focus precise_shots, steady_focus
0:49.048 trickshots O steady_shot Fluffy_Pillow 13.2/100: 13% focus steady_focus, trick_shots
0:50.435 trickshots F steady_shot Fluffy_Pillow 31.9/100: 32% focus steady_focus, trick_shots
0:51.822 trickshots G double_tap Fluffy_Pillow 50.7/100: 51% focus steady_focus, trick_shots
0:53.012 trickshots J aimed_shot Fluffy_Pillow 58.3/100: 58% focus double_tap, steady_focus, trick_shots
0:54.991 trickshots L multishot Fluffy_Pillow 35.8/100: 36% focus precise_shots, steady_focus
0:56.180 trickshots O steady_shot Fluffy_Pillow 23.3/100: 23% focus steady_focus, trick_shots
0:57.568 trickshots O steady_shot Fluffy_Pillow 42.1/100: 42% focus steady_focus, trick_shots
0:58.956 trickshots J aimed_shot Fluffy_Pillow 60.9/100: 61% focus steady_focus, trick_shots
1:00.933 trickshots L multishot Fluffy_Pillow 38.4/100: 38% focus precise_shots(2), steady_focus
1:02.121 trickshots O steady_shot Fluffy_Pillow 25.9/100: 26% focus precise_shots, steady_focus, trick_shots
1:03.509 trickshots K rapid_fire Fluffy_Pillow 44.7/100: 45% focus precise_shots, steady_focus, trick_shots
1:05.615 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus
1:06.804 trickshots O steady_shot Fluffy_Pillow 52.5/100: 53% focus steady_focus, trick_shots
1:08.189 trickshots J aimed_shot Fluffy_Pillow 71.3/100: 71% focus steady_focus, trick_shots
1:10.165 trickshots L multishot Fluffy_Pillow 48.8/100: 49% focus precise_shots(2), steady_focus
1:11.354 trickshots O steady_shot Fluffy_Pillow 36.3/100: 36% focus precise_shots, steady_focus, trick_shots
1:12.744 trickshots F steady_shot Fluffy_Pillow 55.1/100: 55% focus precise_shots, steady_focus, trick_shots
1:14.130 trickshots L multishot Fluffy_Pillow 73.8/100: 74% focus precise_shots, steady_focus, trick_shots
1:15.318 trickshots N multishot Fluffy_Pillow 61.4/100: 61% focus steady_focus, trick_shots
1:16.504 trickshots O steady_shot Fluffy_Pillow 48.9/100: 49% focus steady_focus, trick_shots
1:17.891 trickshots J aimed_shot Fluffy_Pillow 67.6/100: 68% focus lock_and_load, steady_focus, trick_shots
1:19.081 trickshots L multishot Fluffy_Pillow 75.2/100: 75% focus precise_shots, steady_focus
1:20.271 trickshots J aimed_shot Fluffy_Pillow 62.7/100: 63% focus steady_focus, trick_shots
1:22.252 trickshots L multishot Fluffy_Pillow 40.2/100: 40% focus precise_shots(2), steady_focus
1:23.442 trickshots O steady_shot Fluffy_Pillow 27.8/100: 28% focus precise_shots, steady_focus, trick_shots
1:24.830 trickshots F steady_shot Fluffy_Pillow 46.6/100: 47% focus precise_shots, steady_focus, trick_shots
1:26.217 trickshots K rapid_fire Fluffy_Pillow 65.3/100: 65% focus precise_shots, steady_focus, trick_shots
1:28.108 trickshots L multishot Fluffy_Pillow 84.3/100: 84% focus precise_shots, steady_focus
1:29.296 trickshots J aimed_shot Fluffy_Pillow 71.8/100: 72% focus steady_focus, trick_shots
1:31.276 default 9 use_items Fluffy_Pillow 49.4/100: 49% focus precise_shots, steady_focus
1:31.276 trickshots L multishot Fluffy_Pillow 49.4/100: 49% focus precise_shots, steady_focus
1:32.464 trickshots O steady_shot Fluffy_Pillow 36.9/100: 37% focus steady_focus, trick_shots
1:33.852 trickshots N multishot Fluffy_Pillow 55.7/100: 56% focus steady_focus, trick_shots
1:35.040 trickshots O steady_shot Fluffy_Pillow 43.2/100: 43% focus steady_focus, trick_shots
1:36.427 trickshots F steady_shot Fluffy_Pillow 62.0/100: 62% focus steady_focus, trick_shots
1:37.813 trickshots J aimed_shot Fluffy_Pillow 80.7/100: 81% focus steady_focus, trick_shots
1:39.789 trickshots L multishot Fluffy_Pillow 58.2/100: 58% focus precise_shots, steady_focus
1:40.978 trickshots O steady_shot Fluffy_Pillow 45.8/100: 46% focus steady_focus, trick_shots
1:42.364 trickshots N multishot Fluffy_Pillow 64.5/100: 65% focus steady_focus, trick_shots
1:43.553 trickshots O steady_shot Fluffy_Pillow 52.1/100: 52% focus steady_focus, trick_shots
1:44.938 trickshots N multishot Fluffy_Pillow 70.8/100: 71% focus steady_focus, trick_shots
1:46.126 trickshots J aimed_shot Fluffy_Pillow 58.4/100: 58% focus steady_focus, trick_shots
1:48.307 trickshots L multishot Fluffy_Pillow 37.2/100: 37% focus precise_shots, steady_focus
1:49.496 trickshots K rapid_fire Fluffy_Pillow 24.7/100: 25% focus steady_focus, trick_shots
1:51.475 trickshots L multishot Fluffy_Pillow 44.2/100: 44% focus steady_focus
1:52.662 trickshots G double_tap Fluffy_Pillow 31.7/100: 32% focus steady_focus, trick_shots
1:53.851 trickshots O steady_shot Fluffy_Pillow 38.8/100: 39% focus double_tap, trick_shots
1:55.332 trickshots F steady_shot Fluffy_Pillow 57.6/100: 58% focus double_tap, trick_shots
1:56.815 trickshots J aimed_shot Fluffy_Pillow 76.3/100: 76% focus double_tap, steady_focus, trick_shots
1:58.794 trickshots L multishot Fluffy_Pillow 53.9/100: 54% focus precise_shots, steady_focus
1:59.982 trickshots O steady_shot Fluffy_Pillow 41.4/100: 41% focus steady_focus, trick_shots
2:01.367 trickshots H wild_spirits Fluffy_Pillow 60.2/100: 60% focus steady_focus, trick_shots
2:02.675 trickshots I trueshot Fluffy_Pillow 68.4/100: 68% focus steady_focus, trick_shots
2:02.675 cds D blood_fury Fluffy_Pillow 68.4/100: 68% focus steady_focus, trick_shots, trueshot, eagletalons_true_focus
2:02.675 trickshots N multishot Fluffy_Pillow 68.4/100: 68% focus blood_fury, steady_focus, trick_shots, trueshot, eagletalons_true_focus
2:03.865 trickshots J aimed_shot Fluffy_Pillow 69.7/100: 70% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:05.054 trickshots L multishot Fluffy_Pillow 63.0/100: 63% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
2:06.242 trickshots J aimed_shot Fluffy_Pillow 64.3/100: 64% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:07.665 trickshots L multishot Fluffy_Pillow 59.8/100: 60% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
2:08.855 trickshots K rapid_fire Fluffy_Pillow 61.1/100: 61% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:10.556 trickshots L multishot Fluffy_Pillow 88.3/100: 88% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, eagletalons_true_focus
2:11.744 trickshots J aimed_shot Fluffy_Pillow 89.5/100: 90% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:12.934 trickshots L multishot Fluffy_Pillow 82.1/100: 82% focus blood_fury, precise_shots, trueshot, wild_spirits, eagletalons_true_focus
2:14.205 trickshots J aimed_shot Fluffy_Pillow 83.4/100: 83% focus blood_fury, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:15.476 trickshots L multishot Fluffy_Pillow 76.7/100: 77% focus blood_fury, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
2:16.746 trickshots J aimed_shot Fluffy_Pillow 78.0/100: 78% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:18.019 trickshots L multishot Fluffy_Pillow 71.3/100: 71% focus precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
2:19.291 trickshots J aimed_shot Fluffy_Pillow 72.5/100: 73% focus lock_and_load, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:20.562 trickshots L multishot Fluffy_Pillow 83.8/100: 84% focus precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
2:21.834 trickshots J aimed_shot Fluffy_Pillow 85.1/100: 85% focus precise_shots, trick_shots, trueshot, eagletalons_true_focus
2:23.105 trickshots L multishot Fluffy_Pillow 59.1/100: 59% focus precise_shots(2)
2:24.377 trickshots K rapid_fire Fluffy_Pillow 46.6/100: 47% focus precise_shots, trick_shots
2:26.353 trickshots L multishot Fluffy_Pillow 65.3/100: 65% focus precise_shots
2:27.624 trickshots J aimed_shot Fluffy_Pillow 52.8/100: 53% focus trick_shots
2:29.741 trickshots L multishot Fluffy_Pillow 30.3/100: 30% focus precise_shots(2)
2:31.011 trickshots O steady_shot Fluffy_Pillow 17.8/100: 18% focus precise_shots, trick_shots
2:32.494 trickshots F steady_shot Fluffy_Pillow 36.6/100: 37% focus precise_shots, trick_shots
2:33.978 trickshots L multishot Fluffy_Pillow 55.4/100: 55% focus precise_shots, steady_focus, trick_shots
2:35.166 trickshots J aimed_shot Fluffy_Pillow 42.9/100: 43% focus steady_focus, trick_shots
2:37.145 trickshots L multishot Fluffy_Pillow 20.4/100: 20% focus precise_shots, steady_focus
2:38.334 trickshots O steady_shot Fluffy_Pillow 8.0/100: 8% focus steady_focus, trick_shots
2:39.721 trickshots O steady_shot Fluffy_Pillow 26.7/100: 27% focus steady_focus, trick_shots
2:41.109 trickshots O steady_shot Fluffy_Pillow 45.5/100: 46% focus steady_focus, trick_shots
2:42.496 trickshots J aimed_shot Fluffy_Pillow 64.3/100: 64% focus steady_focus, trick_shots
2:44.552 trickshots L multishot Fluffy_Pillow 42.3/100: 42% focus precise_shots(2), steady_focus
2:45.741 trickshots K rapid_fire Fluffy_Pillow 29.8/100: 30% focus precise_shots, steady_focus, trick_shots
2:47.436 trickshots L multishot Fluffy_Pillow 47.6/100: 48% focus precise_shots, steady_focus
2:48.624 trickshots O steady_shot Fluffy_Pillow 35.1/100: 35% focus steady_focus, trick_shots
2:50.010 trickshots O steady_shot Fluffy_Pillow 53.9/100: 54% focus steady_focus, trick_shots
2:51.395 trickshots N multishot Fluffy_Pillow 72.6/100: 73% focus steady_focus, trick_shots
2:52.581 trickshots G double_tap Fluffy_Pillow 60.1/100: 60% focus steady_focus, trick_shots
2:53.852 trickshots J aimed_shot Fluffy_Pillow 68.2/100: 68% focus double_tap, steady_focus, trick_shots
2:55.832 trickshots L multishot Fluffy_Pillow 45.7/100: 46% focus precise_shots, steady_focus
2:57.021 trickshots O steady_shot Fluffy_Pillow 33.2/100: 33% focus steady_focus, trick_shots
2:58.408 trickshots O steady_shot Fluffy_Pillow 52.0/100: 52% focus steady_focus, trick_shots
2:59.793 trickshots N multishot Fluffy_Pillow 70.8/100: 71% focus steady_focus, trick_shots
3:00.981 trickshots N multishot Fluffy_Pillow 58.3/100: 58% focus steady_focus, trick_shots
3:02.170 default 9 use_items Fluffy_Pillow 45.8/100: 46% focus steady_focus, trick_shots
3:02.170 trickshots J aimed_shot Fluffy_Pillow 45.8/100: 46% focus steady_focus, trick_shots
3:04.149 trickshots L multishot Fluffy_Pillow 23.3/100: 23% focus precise_shots(2), steady_focus
3:05.340 trickshots O steady_shot Fluffy_Pillow 10.9/100: 11% focus precise_shots, steady_focus, trick_shots
3:06.729 trickshots K rapid_fire Fluffy_Pillow 29.7/100: 30% focus precise_shots, steady_focus, trick_shots
3:08.613 trickshots L multishot Fluffy_Pillow 48.6/100: 49% focus precise_shots, steady_focus
3:09.802 trickshots O steady_shot Fluffy_Pillow 36.1/100: 36% focus steady_focus, trick_shots
3:11.190 trickshots F steady_shot Fluffy_Pillow 54.9/100: 55% focus steady_focus, trick_shots
3:12.578 trickshots J aimed_shot Fluffy_Pillow 73.7/100: 74% focus steady_focus, trick_shots
3:14.556 trickshots L multishot Fluffy_Pillow 51.2/100: 51% focus precise_shots(2), steady_focus
3:15.743 trickshots O steady_shot Fluffy_Pillow 38.7/100: 39% focus precise_shots, steady_focus, trick_shots
3:17.129 trickshots L multishot Fluffy_Pillow 57.5/100: 58% focus precise_shots, steady_focus, trick_shots
3:18.316 trickshots O steady_shot Fluffy_Pillow 45.0/100: 45% focus steady_focus, trick_shots
3:19.703 trickshots N multishot Fluffy_Pillow 63.8/100: 64% focus steady_focus, trick_shots
3:20.891 trickshots J aimed_shot Fluffy_Pillow 51.3/100: 51% focus steady_focus, trick_shots
3:22.869 trickshots L multishot Fluffy_Pillow 28.8/100: 29% focus precise_shots(2), steady_focus
3:24.057 trickshots O steady_shot Fluffy_Pillow 16.4/100: 16% focus precise_shots, steady_focus, trick_shots
3:25.444 trickshots F steady_shot Fluffy_Pillow 35.1/100: 35% focus precise_shots, steady_focus, trick_shots
3:26.831 trickshots K rapid_fire Fluffy_Pillow 53.9/100: 54% focus precise_shots, steady_focus, trick_shots
3:28.649 trickshots L multishot Fluffy_Pillow 72.4/100: 72% focus precise_shots, steady_focus
3:29.838 trickshots J aimed_shot Fluffy_Pillow 59.9/100: 60% focus steady_focus, trick_shots
3:31.947 trickshots L multishot Fluffy_Pillow 38.3/100: 38% focus precise_shots(2), steady_focus
3:33.136 trickshots O steady_shot Fluffy_Pillow 25.8/100: 26% focus precise_shots, steady_focus, trick_shots
3:34.524 trickshots O steady_shot Fluffy_Pillow 44.6/100: 45% focus precise_shots, steady_focus, trick_shots
3:35.910 trickshots L multishot Fluffy_Pillow 63.4/100: 63% focus precise_shots, steady_focus, trick_shots
3:37.097 trickshots O steady_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus, trick_shots
3:38.483 trickshots N multishot Fluffy_Pillow 69.7/100: 70% focus steady_focus, trick_shots
3:39.670 trickshots J aimed_shot Fluffy_Pillow 57.2/100: 57% focus steady_focus, trick_shots
3:41.649 trickshots L multishot Fluffy_Pillow 34.7/100: 35% focus lock_and_load, precise_shots, steady_focus
3:42.837 trickshots J aimed_shot Fluffy_Pillow 22.2/100: 22% focus lock_and_load, steady_focus, trick_shots
3:44.025 trickshots L multishot Fluffy_Pillow 29.7/100: 30% focus precise_shots, steady_focus
3:45.213 trickshots O steady_shot Fluffy_Pillow 17.3/100: 17% focus steady_focus, trick_shots
3:46.601 trickshots F steady_shot Fluffy_Pillow 36.0/100: 36% focus steady_focus, trick_shots
3:47.988 trickshots K rapid_fire Fluffy_Pillow 54.8/100: 55% focus steady_focus, trick_shots
3:49.853 trickshots L multishot Fluffy_Pillow 73.6/100: 74% focus steady_focus
3:51.042 trickshots J aimed_shot Fluffy_Pillow 61.1/100: 61% focus steady_focus, trick_shots
3:53.103 trickshots G double_tap Fluffy_Pillow 39.2/100: 39% focus precise_shots(2), steady_focus
3:54.292 trickshots L multishot Fluffy_Pillow 46.7/100: 47% focus double_tap, precise_shots(2), steady_focus
3:55.481 trickshots O steady_shot Fluffy_Pillow 34.2/100: 34% focus double_tap, precise_shots, steady_focus, trick_shots
3:56.867 trickshots O steady_shot Fluffy_Pillow 53.0/100: 53% focus double_tap, precise_shots, steady_focus, trick_shots
3:58.253 trickshots L multishot Fluffy_Pillow 71.8/100: 72% focus double_tap, precise_shots, steady_focus, trick_shots
3:59.441 trickshots N multishot Fluffy_Pillow 59.3/100: 59% focus double_tap, steady_focus, trick_shots
4:00.630 trickshots J aimed_shot Fluffy_Pillow 46.8/100: 47% focus double_tap, steady_focus, trick_shots
4:02.608 trickshots H wild_spirits Fluffy_Pillow 24.3/100: 24% focus precise_shots, steady_focus
4:03.796 trickshots I trueshot Fluffy_Pillow 31.9/100: 32% focus precise_shots, steady_focus
4:03.796 cds D blood_fury Fluffy_Pillow 31.9/100: 32% focus precise_shots, steady_focus, trueshot, eagletalons_true_focus
4:03.796 trickshots L multishot Fluffy_Pillow 31.9/100: 32% focus blood_fury, precise_shots, steady_focus, trueshot, eagletalons_true_focus
4:04.985 trickshots K rapid_fire Fluffy_Pillow 33.2/100: 33% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:06.928 trickshots L multishot Fluffy_Pillow 61.6/100: 62% focus blood_fury, steady_focus, trueshot, wild_spirits, eagletalons_true_focus
4:08.117 trickshots J aimed_shot Fluffy_Pillow 62.9/100: 63% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:09.305 trickshots L multishot Fluffy_Pillow 56.2/100: 56% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, eagletalons_true_focus
4:10.492 trickshots J aimed_shot Fluffy_Pillow 57.4/100: 57% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:11.681 trickshots L multishot Fluffy_Pillow 50.7/100: 51% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
4:12.869 trickshots J aimed_shot Fluffy_Pillow 52.0/100: 52% focus blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:14.059 trickshots L multishot Fluffy_Pillow 62.8/100: 63% focus blood_fury, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
4:15.332 trickshots J aimed_shot Fluffy_Pillow 64.1/100: 64% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:16.604 trickshots L multishot Fluffy_Pillow 57.4/100: 57% focus blood_fury, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
4:17.877 trickshots J aimed_shot Fluffy_Pillow 58.7/100: 59% focus blood_fury, lock_and_load, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:19.149 trickshots L multishot Fluffy_Pillow 70.0/100: 70% focus precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
4:20.421 trickshots J aimed_shot Fluffy_Pillow 71.2/100: 71% focus precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:21.691 trickshots L multishot Fluffy_Pillow 64.5/100: 65% focus precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
4:22.961 trickshots J aimed_shot Fluffy_Pillow 65.8/100: 66% focus precise_shots, trick_shots, trueshot, eagletalons_true_focus
4:24.234 trickshots L multishot Fluffy_Pillow 39.7/100: 40% focus precise_shots(2)
4:25.505 trickshots K rapid_fire Fluffy_Pillow 27.3/100: 27% focus precise_shots, trick_shots
4:27.382 trickshots L multishot Fluffy_Pillow 45.4/100: 45% focus precise_shots
4:28.654 trickshots O steady_shot Fluffy_Pillow 32.9/100: 33% focus trick_shots
4:30.138 trickshots F steady_shot Fluffy_Pillow 51.7/100: 52% focus trick_shots
4:31.621 trickshots J aimed_shot Fluffy_Pillow 70.4/100: 70% focus steady_focus, trick_shots
4:33.599 default 9 use_items Fluffy_Pillow 48.0/100: 48% focus precise_shots, steady_focus
4:33.599 trickshots L multishot Fluffy_Pillow 48.0/100: 48% focus precise_shots, steady_focus
4:34.788 trickshots M kill_shot Fluffy_Pillow 35.5/100: 35% focus steady_focus, trick_shots
4:35.976 trickshots O steady_shot Fluffy_Pillow 33.0/100: 33% focus steady_focus, trick_shots
4:37.363 trickshots J aimed_shot Fluffy_Pillow 51.8/100: 52% focus steady_focus, trick_shots
4:39.341 trickshots L multishot Fluffy_Pillow 29.3/100: 29% focus precise_shots(2), steady_focus
4:40.530 trickshots O steady_shot Fluffy_Pillow 16.8/100: 17% focus precise_shots, steady_focus, trick_shots
4:41.917 trickshots F steady_shot Fluffy_Pillow 35.6/100: 36% focus precise_shots, steady_focus, trick_shots
4:43.303 trickshots O steady_shot Fluffy_Pillow 54.4/100: 54% focus precise_shots, steady_focus, trick_shots
4:44.689 trickshots L multishot Fluffy_Pillow 73.2/100: 73% focus precise_shots, steady_focus, trick_shots
4:45.880 trickshots K rapid_fire Fluffy_Pillow 60.7/100: 61% focus steady_focus, trick_shots
4:47.723 trickshots L multishot Fluffy_Pillow 79.4/100: 79% focus steady_focus
4:48.913 trickshots J aimed_shot Fluffy_Pillow 66.9/100: 67% focus steady_focus, trick_shots
4:50.891 trickshots L multishot Fluffy_Pillow 44.4/100: 44% focus precise_shots, steady_focus
4:52.081 trickshots M kill_shot Fluffy_Pillow 31.9/100: 32% focus steady_focus, trick_shots
4:53.269 trickshots G double_tap Fluffy_Pillow 29.5/100: 29% focus steady_focus, trick_shots
4:54.458 trickshots O steady_shot Fluffy_Pillow 37.0/100: 37% focus double_tap, steady_focus, trick_shots
4:55.844 trickshots F steady_shot Fluffy_Pillow 55.8/100: 56% focus double_tap, steady_focus, trick_shots
4:57.231 trickshots J aimed_shot Fluffy_Pillow 74.5/100: 75% focus double_tap, steady_focus, trick_shots
4:59.211 trickshots L multishot Fluffy_Pillow 52.1/100: 52% focus precise_shots(2), steady_focus
5:00.401 trickshots O steady_shot Fluffy_Pillow 39.6/100: 40% focus precise_shots, steady_focus, trick_shots
5:01.787 trickshots L multishot Fluffy_Pillow 58.4/100: 58% focus precise_shots, steady_focus, trick_shots
5:02.974 trickshots M kill_shot Fluffy_Pillow 45.9/100: 46% focus steady_focus, trick_shots
5:04.163 trickshots O steady_shot Fluffy_Pillow 43.4/100: 43% focus steady_focus, trick_shots
5:05.549 trickshots J aimed_shot Fluffy_Pillow 62.2/100: 62% focus steady_focus, trick_shots
5:07.528 trickshots L multishot Fluffy_Pillow 39.7/100: 40% focus precise_shots(2), steady_focus
5:08.716 trickshots K rapid_fire Fluffy_Pillow 27.2/100: 27% focus precise_shots, steady_focus, trick_shots
5:10.524 trickshots L multishot Fluffy_Pillow 45.7/100: 46% focus precise_shots, steady_focus
5:11.712 trickshots O steady_shot Fluffy_Pillow 33.2/100: 33% focus steady_focus, trick_shots
5:13.099 cds E potion Fluffy_Pillow 51.6/100: 52% focus trick_shots
5:13.099 trickshots F steady_shot Fluffy_Pillow 51.6/100: 52% focus trick_shots, potion_of_spectral_agility
5:14.583 trickshots M kill_shot Fluffy_Pillow 70.4/100: 70% focus steady_focus, trick_shots, potion_of_spectral_agility
5:15.771 trickshots J aimed_shot Fluffy_Pillow 67.9/100: 68% focus steady_focus, trick_shots, potion_of_spectral_agility
5:17.749 trickshots L multishot Fluffy_Pillow 45.4/100: 45% focus precise_shots, steady_focus, potion_of_spectral_agility
5:18.939 trickshots O steady_shot Fluffy_Pillow 33.0/100: 33% focus steady_focus, trick_shots, potion_of_spectral_agility
5:20.324 trickshots O steady_shot Fluffy_Pillow 51.7/100: 52% focus steady_focus, trick_shots, potion_of_spectral_agility
5:21.710 trickshots N multishot Fluffy_Pillow 70.5/100: 70% focus steady_focus, trick_shots, potion_of_spectral_agility
5:22.899 trickshots N multishot Fluffy_Pillow 58.0/100: 58% focus steady_focus, trick_shots, potion_of_spectral_agility
5:24.088 trickshots O steady_shot Fluffy_Pillow 45.5/100: 46% focus steady_focus, trick_shots, potion_of_spectral_agility
5:25.474 trickshots J aimed_shot Fluffy_Pillow 64.3/100: 64% focus steady_focus, trick_shots, potion_of_spectral_agility
5:27.452 trickshots L multishot Fluffy_Pillow 41.8/100: 42% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:28.640 trickshots K rapid_fire Fluffy_Pillow 29.4/100: 29% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:30.480 trickshots L multishot Fluffy_Pillow 48.0/100: 48% focus precise_shots, steady_focus, potion_of_spectral_agility
5:31.670 trickshots M kill_shot Fluffy_Pillow 35.5/100: 36% focus steady_focus, trick_shots, potion_of_spectral_agility
5:32.857 trickshots O steady_shot Fluffy_Pillow 33.0/100: 33% focus steady_focus, trick_shots, potion_of_spectral_agility
5:34.246 trickshots F steady_shot Fluffy_Pillow 51.8/100: 52% focus steady_focus, trick_shots, potion_of_spectral_agility
5:35.633 trickshots J aimed_shot Fluffy_Pillow 70.6/100: 71% focus steady_focus, trick_shots, potion_of_spectral_agility
5:37.612 trickshots L multishot Fluffy_Pillow 48.1/100: 48% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:38.799 trickshots O steady_shot Fluffy_Pillow 35.7/100: 36% focus precise_shots, steady_focus, trick_shots

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Eagletalon's True Focus }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="eagle_true_focus"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7011,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

marksmanship : 7067 dps, 3195 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
7066.6 7066.6 11.3 / 0.159% 794.6 / 11.2% 704.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.0 9.8 Focus 0.00% 47.1 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
marksmanship 7067
Aimed Shot 2365 (2634) 33.5% (37.2%) 46.7 6.40sec 16936 10697 Direct 140.0 (155.5) 4143 8261 5075 22.6% (22.7%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.72 140.02 0.00 0.00 1.5832 0.0000 710700.30 1015164.31 29.99% 10697.26 10697.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.35% 108.31 73 150 4142.92 2524 9493 4144.53 3839 4469 448730 640965 29.99%
crit 22.65% 31.71 15 54 8261.14 5048 18985 8268.93 6480 10139 261971 374199 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [I]:46.93
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 269 3.8% 0.0 0.00sec 0 0 Direct 15.5 4212 8568 5214 23.0%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 15.45 0.00 0.00 0.0000 0.0000 80618.67 115155.70 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.99% 11.90 2 18 4212.19 2524 9493 4228.67 3179 6371 50097 71559 29.99%
crit 23.01% 3.56 0 10 8567.59 5048 18985 8372.01 0 18985 30521 43597 29.11%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 373 5.3% 113.9 2.65sec 985 434 Direct 113.7 805 1609 987 22.6%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.87 113.65 0.00 0.00 2.2672 0.0000 112155.73 160203.24 29.99% 434.42 434.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.39% 87.95 61 117 804.95 774 970 804.87 789 821 70795 101124 29.99%
crit 22.61% 25.70 11 43 1609.17 1548 1940 1608.99 1558 1673 41360 59079 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 140 2.0% 3.8 90.73sec 11162 0 Direct 3.7 9041 18093 11201 23.8%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.75 3.74 0.00 0.00 0.0000 0.0000 41880.05 41880.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.17% 2.85 0 4 9040.61 8937 9474 8998.19 0 9474 25756 25756 0.00%
crit 23.83% 0.89 0 4 18093.45 17875 18947 11586.84 0 18947 16124 16124 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.6% 22.1 13.17sec 544 0 Direct 22.1 442 884 544 23.1%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.08 22.08 0.00 0.00 0.0000 0.0000 12012.98 12012.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.85% 16.97 6 31 441.75 435 461 441.75 435 454 7495 7495 0.00%
crit 23.15% 5.11 0 14 883.97 871 923 880.51 0 923 4517 4517 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 84 1.2% 4.7 13.19sec 5384 4510 Direct 4.6 4224 9516 5428 22.7%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.68 4.64 0.00 0.00 1.1936 0.0000 25204.42 36001.99 29.99% 4510.45 4510.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.30% 3.59 0 7 4224.28 4065 4796 4203.64 0 4796 15168 21666 29.90%
crit 22.70% 1.05 0 5 9516.18 9146 10792 6666.51 0 10792 10036 14336 21.01%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [L]:4.68
  • if_expr:buff.dead_eye.down
Master Marksman 317 4.5% 196.7 1.54sec 484 0 Periodic 329.6 289 0 289 0.0% 73.0%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 196.71 0.00 329.60 329.60 0.0000 2.0000 95293.32 95293.32 0.00% 144.56 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 329.60 236 423 289.00 37 1958 289.09 228 360 95293 95293 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 1604 22.7% 82.3 3.66sec 5862 5143 Direct 246.3 1595 3188 1958 22.8%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.27 246.32 0.00 0.00 1.1397 0.0000 482265.33 688867.79 29.99% 5143.18 5143.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.23% 190.24 142 238 1595.19 953 2090 1595.03 1481 1698 303464 433468 29.99%
crit 22.77% 56.08 32 84 3187.90 1905 4180 3187.44 2787 3481 178801 255399 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [K]:73.89
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [M]:8.38
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 687 9.7% 16.1 18.84sec 12836 7350 Periodic 343.9 490 979 600 22.6% 2.7%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.09 0.00 115.00 343.87 1.7464 0.2091 206472.07 294924.70 29.99% 7349.85 7349.85
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.38% 266.09 178 358 489.61 351 881 489.60 467 510 130285 186099 29.99%
crit 22.62% 77.78 43 118 979.50 703 1762 979.42 857 1101 76187 108826 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [J]:16.08
  • if_expr:buff.trick_shots.remains>=execute_time
Serpent Sting 787 11.1% 0.0 0.00sec 0 0 Direct 46.6 501 1001 615 22.8%
Periodic 352.2 481 963 591 22.7% 86.6%

Stats Details: Serpent Sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 46.62 352.19 352.19 0.0000 2.2193 236747.25 236747.25 0.00% 302.90 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.20% 35.99 21 50 500.96 479 600 500.96 491 513 18029 18029 0.00%
crit 22.80% 10.63 2 20 1001.25 958 1201 1001.48 958 1099 10641 10641 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.26% 272.10 191 354 481.37 0 600 481.29 469 491 130983 130983 0.00%
crit 22.74% 80.09 50 131 962.51 1 1201 962.40 904 1008 77094 77094 0.00%

Action Details: Serpent Sting

  • id:271788
  • school:nature
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.165000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:271788
  • name:Serpent Sting
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Fire a shot that poisons your target, causing them to take {$s1=0} Nature damage instantly and an additional $o2 Nature damage over {$d=18 seconds}.
Shadowcore Oil Blast 44 0.6% 44.2 6.71sec 297 0 Direct 44.2 243 485 297 22.5%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.19 44.19 0.00 0.00 0.0000 0.0000 13134.47 13134.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.46% 34.23 18 54 242.52 239 254 242.52 239 247 8302 8302 0.00%
crit 22.54% 9.96 2 22 485.13 479 508 485.09 479 500 4832 4832 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 359 5.1% 69.1 4.34sec 1563 1160 Direct 70.0 1257 2514 1543 22.7%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.12 70.02 0.00 0.00 1.3474 0.0000 108024.89 154302.75 29.99% 1159.87 1159.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.28% 54.12 36 75 1256.97 1219 1529 1256.65 1229 1283 68024 97166 29.99%
crit 22.72% 15.91 5 28 2514.18 2439 3057 2513.87 2439 2676 40001 57137 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:15.68
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [N]:53.74
Simple Action Stats Execute Interval
marksmanship
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:marksmanship
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.59sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.98
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.62sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 0.00 0.00 0.00 0.9782 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.63
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:marksmanship
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:marksmanship
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 309.26sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.48
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.60sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [H]:2.98

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.6sec 120.6sec 14.7sec 14.69% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.69%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.5sec 60.6sec 4.6sec 8.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.2s

Stack Uptimes

  • double_tap_1:8.67%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 9.0 0.2 30.2sec 29.4sec 1.9sec 5.57% 18.77% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 217.2s
  • trigger_min/max:1.8s / 217.2s
  • trigger_pct:8.09%
  • duration_min/max:0.0s / 11.1s

Stack Uptimes

  • lock_and_load_1:5.57%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.4sec 309.4sec 23.1sec 11.24% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 333.3s
  • trigger_min/max:300.0s / 333.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.24%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.9 5.8 7.3sec 6.4sec 2.7sec 36.93% 80.92% 2.9 (2.9) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 31.2s
  • trigger_min/max:0.9s / 14.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s

Stack Uptimes

  • precise_shots_1:32.04%
  • precise_shots_2:4.89%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 5.9 19.4 54.5sec 12.0sec 48.6sec 95.03% 0.00% 19.4 (19.4) 5.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 271.4s
  • trigger_min/max:3.0s / 35.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 286.1s

Stack Uptimes

  • steady_focus_1:95.03%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 63.6 18.7 4.7sec 3.7sec 4.2sec 89.78% 100.00% 18.7 (18.7) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.5s
  • trigger_min/max:0.9s / 11.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.5s

Stack Uptimes

  • trick_shots_1:89.78%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.6sec 120.6sec 14.7sec 14.68% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • trueshot_1:14.68%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 5.2 2.0 7.0 62.2s 48.0s 244.4s
double_tap_rapid_fire 0.4 0.0 3.0 82.6s 57.0s 242.6s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.52% 0.41% 1.07% 0.6s 0.0s 1.5s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7570.0012.6822.9020.0007.638
Aimed Shot1.1890.0016.9169.5902.15022.877
Kill Shot3.5840.00122.79812.1550.00030.445
Trueshot0.7370.0012.7041.2150.0004.939
Rapid Fire2.7300.00120.11735.42013.57362.761

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
marksmanship
steady_shot Focus 70.12 681.16 23.08% 9.71 20.03 2.86%
rapid_fire Focus 114.97 114.89 3.89% 1.00 0.07 0.06%
focus_regen Focus 581.62 1960.23 66.41% 3.37 10.91 0.55%
Trueshot Focus 117.42 195.34 6.62% 1.66 1.12 0.57%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.81 10.02 32.1 36.2 0.2 92.8
Usage Type Count Total Avg RPE APR
marksmanship
aimed_shot Focus 46.7 1323.2 28.3 28.3 598.0
kill_shot Focus 4.7 46.8 10.0 10.0 538.3
multishot Focus 82.3 1645.3 20.0 20.0 293.1

Statistics & Data Analysis

Fight Length
marksmanship Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
marksmanship Damage Per Second
Count 1323
Mean 7066.57
Minimum 6494.34
Maximum 7846.21
Spread ( max - min ) 1351.87
Range [ ( max - min ) / 2 * 100% ] 9.57%
Standard Deviation 209.1166
5th Percentile 6732.11
95th Percentile 7414.66
( 95th Percentile - 5th Percentile ) 682.55
Mean Distribution
Standard Deviation 5.7492
95.00% Confidence Interval ( 7055.30 - 7077.84 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3364
0.1 Scale Factor Error with Delta=300 374
0.05 Scale Factor Error with Delta=300 1494
0.01 Scale Factor Error with Delta=300 37331
Priority Target DPS
marksmanship Priority Target Damage Per Second
Count 1323
Mean 3194.52
Minimum 2858.10
Maximum 3692.36
Spread ( max - min ) 834.26
Range [ ( max - min ) / 2 * 100% ] 13.06%
Standard Deviation 111.7728
5th Percentile 3018.98
95th Percentile 3379.93
( 95th Percentile - 5th Percentile ) 360.96
Mean Distribution
Standard Deviation 3.0730
95.00% Confidence Interval ( 3188.50 - 3200.54 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4703
0.1 Scale Factor Error with Delta=300 107
0.05 Scale Factor Error with Delta=300 427
0.01 Scale Factor Error with Delta=300 10665
DPS(e)
marksmanship Damage Per Second (Effective)
Count 1323
Mean 7066.57
Minimum 6494.34
Maximum 7846.21
Spread ( max - min ) 1351.87
Range [ ( max - min ) / 2 * 100% ] 9.57%
Damage
marksmanship Damage
Count 1323
Mean 2124509.46
Minimum 1587911.89
Maximum 2663985.93
Spread ( max - min ) 1076074.03
Range [ ( max - min ) / 2 * 100% ] 25.33%
DTPS
marksmanship Damage Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
marksmanship Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
marksmanship Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
marksmanship Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
marksmanship Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
marksmanship Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
marksmanshipTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
marksmanship Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.76 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.98 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.48 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 15.68 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.63 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
0.00 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
H 2.98 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
I 46.93 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
J 16.08 rapid_fire,if=buff.trick_shots.remains>=execute_time
K 73.89 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
L 4.68 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
M 8.38 multishot,if=focus>cost+action.aimed_shot.cost
N 53.74 steady_shot

Sample Sequence

0125789FHDEKIKIKJKIKNINFKIKIKJKINFKNKIKINKNNKIKNJKIKNFKIGKIKIKNFIKJKIKNIKNFNMIKNJKNF9IKNKIKNKIKNFJKIGKNNMIKHDNJKIKINFKIKJKINKNFIKNNKIKJKNIKNFNKIKGNNJKI9KKIKNFMNIKNNJKIKNMNFMIKNKNJKIKNFMMIKGNNKIKJHDKIKNFIKINKINKJKNFIKIKNL9NKNFIKJKLIKNFKNGIKLNNJKIKLNMNEFIKNKLIKIKJKNFIKLNN

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask marksmanship 100.0/100: 100% focus
Pre precombat 1 augmentation marksmanship 100.0/100: 100% focus
Pre precombat 2 food marksmanship 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.484 trickshots H trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:01.484 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:01.484 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:01.484 trickshots K multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:02.398 trickshots I aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:03.313 trickshots K multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:04.231 trickshots I aimed_shot enemy2 58.3/100: 58% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:05.146 trickshots K multishot Fluffy_Pillow 34.5/100: 35% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:06.060 trickshots J rapid_fire Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:07.486 trickshots K multishot Fluffy_Pillow 52.4/100: 52% focus bloodlust, blood_fury, steady_focus, trueshot, potion_of_spectral_agility
0:08.404 trickshots I aimed_shot enemy3 43.8/100: 44% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:09.319 trickshots K multishot Fluffy_Pillow 20.1/100: 20% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:10.234 trickshots N steady_shot Fluffy_Pillow 11.3/100: 11% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:11.300 trickshots I aimed_shot Fluffy_Pillow 39.5/100: 40% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:12.215 trickshots N steady_shot Fluffy_Pillow 15.8/100: 16% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:13.282 trickshots F steady_shot Fluffy_Pillow 44.0/100: 44% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:14.351 trickshots K multishot Fluffy_Pillow 72.2/100: 72% focus bloodlust, blood_fury, lock_and_load, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:15.265 trickshots I aimed_shot enemy2 63.4/100: 63% focus bloodlust, blood_fury, lock_and_load, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:16.181 trickshots K multishot Fluffy_Pillow 74.7/100: 75% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:17.096 trickshots I aimed_shot enemy3 63.5/100: 64% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:18.620 trickshots K multishot Fluffy_Pillow 41.1/100: 41% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:19.536 trickshots J rapid_fire Fluffy_Pillow 28.6/100: 29% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:21.111 trickshots K multishot Fluffy_Pillow 48.6/100: 49% focus bloodlust, steady_focus, potion_of_spectral_agility
0:22.026 trickshots I aimed_shot Fluffy_Pillow 36.1/100: 36% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:23.552 trickshots N steady_shot Fluffy_Pillow 13.6/100: 14% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:24.617 trickshots F steady_shot Fluffy_Pillow 32.4/100: 32% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:25.684 trickshots K multishot Fluffy_Pillow 51.2/100: 51% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:26.600 trickshots N steady_shot Fluffy_Pillow 38.7/100: 39% focus bloodlust, precise_shots, steady_focus, trick_shots
0:27.667 trickshots K multishot Fluffy_Pillow 57.5/100: 57% focus bloodlust, precise_shots, steady_focus, trick_shots
0:28.582 trickshots I aimed_shot enemy2 45.0/100: 45% focus bloodlust, steady_focus, trick_shots
0:30.104 trickshots K multishot Fluffy_Pillow 22.5/100: 23% focus bloodlust, lock_and_load, precise_shots, steady_focus
0:31.019 trickshots I aimed_shot enemy3 10.1/100: 10% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:31.933 trickshots N steady_shot Fluffy_Pillow 17.6/100: 18% focus bloodlust, precise_shots(2), steady_focus
0:33.001 trickshots K multishot Fluffy_Pillow 36.4/100: 36% focus bloodlust, precise_shots(2), steady_focus
0:33.916 trickshots N steady_shot Fluffy_Pillow 23.9/100: 24% focus bloodlust, precise_shots, steady_focus, trick_shots
0:34.983 trickshots N steady_shot Fluffy_Pillow 42.7/100: 43% focus bloodlust, precise_shots, steady_focus, trick_shots
0:36.052 trickshots K multishot Fluffy_Pillow 61.5/100: 61% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:36.969 trickshots I aimed_shot Fluffy_Pillow 49.0/100: 49% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:37.886 trickshots K multishot Fluffy_Pillow 56.6/100: 57% focus bloodlust, precise_shots(2), steady_focus
0:38.802 trickshots N steady_shot Fluffy_Pillow 44.1/100: 44% focus bloodlust, precise_shots, steady_focus, trick_shots
0:39.869 trickshots J rapid_fire Fluffy_Pillow 62.9/100: 63% focus bloodlust, precise_shots, steady_focus, trick_shots
0:41.392 trickshots K multishot Fluffy_Pillow 81.7/100: 82% focus precise_shots, steady_focus
0:42.582 trickshots I aimed_shot enemy2 69.2/100: 69% focus steady_focus, trick_shots
0:44.561 trickshots K multishot Fluffy_Pillow 46.7/100: 47% focus precise_shots(2), steady_focus
0:45.750 trickshots N steady_shot Fluffy_Pillow 34.3/100: 34% focus precise_shots, steady_focus, trick_shots
0:47.138 trickshots F steady_shot Fluffy_Pillow 53.0/100: 53% focus precise_shots, steady_focus, trick_shots
0:48.524 trickshots K multishot Fluffy_Pillow 71.8/100: 72% focus precise_shots, steady_focus, trick_shots
0:49.712 trickshots I aimed_shot enemy3 59.3/100: 59% focus steady_focus, trick_shots
0:51.692 trickshots G double_tap Fluffy_Pillow 36.9/100: 37% focus lock_and_load, precise_shots, steady_focus
0:52.881 trickshots K multishot Fluffy_Pillow 44.4/100: 44% focus double_tap, lock_and_load, precise_shots, steady_focus
0:54.068 trickshots I aimed_shot Fluffy_Pillow 31.9/100: 32% focus double_tap, lock_and_load, steady_focus, trick_shots
0:55.256 trickshots K multishot Fluffy_Pillow 39.4/100: 39% focus precise_shots, steady_focus
0:56.445 trickshots I aimed_shot enemy2 27.0/100: 27% focus lock_and_load, steady_focus, trick_shots
0:57.634 trickshots K multishot Fluffy_Pillow 34.5/100: 34% focus precise_shots, steady_focus
0:58.822 trickshots N steady_shot Fluffy_Pillow 22.0/100: 22% focus steady_focus, trick_shots
1:00.208 trickshots F steady_shot Fluffy_Pillow 40.8/100: 41% focus steady_focus, trick_shots
1:01.595 trickshots I aimed_shot enemy3 59.5/100: 60% focus steady_focus, trick_shots
1:03.575 trickshots K multishot Fluffy_Pillow 37.1/100: 37% focus precise_shots(2), steady_focus
1:04.763 trickshots J rapid_fire Fluffy_Pillow 24.6/100: 25% focus precise_shots, steady_focus, trick_shots
1:06.535 trickshots K multishot Fluffy_Pillow 42.8/100: 43% focus lock_and_load, precise_shots, steady_focus
1:07.725 trickshots I aimed_shot Fluffy_Pillow 30.3/100: 30% focus lock_and_load, steady_focus, trick_shots
1:08.912 trickshots K multishot Fluffy_Pillow 37.9/100: 38% focus precise_shots, steady_focus
1:10.101 trickshots N steady_shot Fluffy_Pillow 25.4/100: 25% focus steady_focus, trick_shots
1:11.486 trickshots I aimed_shot enemy2 44.2/100: 44% focus steady_focus, trick_shots
1:13.466 trickshots K multishot Fluffy_Pillow 21.7/100: 22% focus precise_shots, steady_focus
1:14.655 trickshots N steady_shot Fluffy_Pillow 9.2/100: 9% focus steady_focus, trick_shots
1:16.042 trickshots F steady_shot Fluffy_Pillow 28.0/100: 28% focus steady_focus, trick_shots
1:17.429 trickshots N steady_shot Fluffy_Pillow 46.4/100: 46% focus steady_focus, trick_shots
1:18.816 trickshots M multishot Fluffy_Pillow 65.2/100: 65% focus steady_focus, trick_shots
1:20.007 trickshots I aimed_shot enemy3 52.7/100: 53% focus steady_focus, trick_shots
1:22.156 trickshots K multishot Fluffy_Pillow 31.3/100: 31% focus precise_shots(2), steady_focus
1:23.345 trickshots N steady_shot Fluffy_Pillow 18.9/100: 19% focus precise_shots, steady_focus, trick_shots
1:24.731 trickshots J rapid_fire Fluffy_Pillow 37.6/100: 38% focus precise_shots, steady_focus, trick_shots
1:26.579 trickshots K multishot Fluffy_Pillow 56.3/100: 56% focus precise_shots, steady_focus
1:27.768 trickshots N steady_shot Fluffy_Pillow 43.9/100: 44% focus steady_focus, trick_shots
1:29.155 trickshots F steady_shot Fluffy_Pillow 62.6/100: 63% focus steady_focus, trick_shots
1:30.542 default 9 use_items Fluffy_Pillow 81.4/100: 81% focus steady_focus, trick_shots
1:30.542 trickshots I aimed_shot Fluffy_Pillow 81.4/100: 81% focus steady_focus, trick_shots
1:32.520 trickshots K multishot Fluffy_Pillow 58.9/100: 59% focus precise_shots(2), steady_focus
1:33.707 trickshots N steady_shot Fluffy_Pillow 46.4/100: 46% focus precise_shots, steady_focus, trick_shots
1:35.091 trickshots K multishot Fluffy_Pillow 65.2/100: 65% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:36.280 trickshots I aimed_shot enemy2 52.7/100: 53% focus lock_and_load, steady_focus, trick_shots
1:37.470 trickshots K multishot Fluffy_Pillow 60.3/100: 60% focus precise_shots(2), steady_focus
1:38.658 trickshots N steady_shot Fluffy_Pillow 47.8/100: 48% focus precise_shots, steady_focus, trick_shots
1:40.043 trickshots K multishot Fluffy_Pillow 66.5/100: 67% focus precise_shots, steady_focus, trick_shots
1:41.232 trickshots I aimed_shot enemy3 54.1/100: 54% focus steady_focus, trick_shots
1:43.212 trickshots K multishot Fluffy_Pillow 31.6/100: 32% focus precise_shots, steady_focus
1:44.402 trickshots N steady_shot Fluffy_Pillow 19.1/100: 19% focus steady_focus, trick_shots
1:45.791 trickshots F steady_shot Fluffy_Pillow 37.8/100: 38% focus trick_shots
1:47.275 trickshots J rapid_fire Fluffy_Pillow 56.6/100: 57% focus steady_focus, trick_shots
1:49.127 trickshots K multishot Fluffy_Pillow 75.3/100: 75% focus steady_focus
1:50.316 trickshots I aimed_shot Fluffy_Pillow 62.9/100: 63% focus steady_focus, trick_shots
1:52.295 trickshots G double_tap Fluffy_Pillow 40.4/100: 40% focus precise_shots, steady_focus
1:53.482 trickshots K multishot Fluffy_Pillow 47.9/100: 48% focus double_tap, precise_shots, steady_focus
1:54.670 trickshots N steady_shot Fluffy_Pillow 35.4/100: 35% focus double_tap, steady_focus, trick_shots
1:56.056 trickshots N steady_shot Fluffy_Pillow 54.2/100: 54% focus double_tap, steady_focus, trick_shots
1:57.443 trickshots M multishot Fluffy_Pillow 73.0/100: 73% focus double_tap, steady_focus, trick_shots
1:58.631 trickshots I aimed_shot enemy2 60.5/100: 60% focus double_tap, steady_focus, trick_shots
2:00.609 trickshots K multishot Fluffy_Pillow 38.0/100: 38% focus precise_shots, steady_focus
2:01.799 trickshots H trueshot Fluffy_Pillow 25.5/100: 26% focus steady_focus, trick_shots
2:01.799 cds D blood_fury Fluffy_Pillow 25.5/100: 26% focus steady_focus, trick_shots, trueshot
2:01.799 trickshots N steady_shot Fluffy_Pillow 25.5/100: 26% focus blood_fury, steady_focus, trick_shots, trueshot
2:03.183 trickshots J rapid_fire Fluffy_Pillow 53.7/100: 54% focus blood_fury, steady_focus, trick_shots, trueshot
2:05.276 trickshots K multishot Fluffy_Pillow 84.5/100: 85% focus blood_fury, steady_focus, trueshot
2:06.466 trickshots I aimed_shot enemy3 75.8/100: 76% focus blood_fury, steady_focus, trick_shots, trueshot
2:07.655 trickshots K multishot Fluffy_Pillow 52.1/100: 52% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:08.844 trickshots I aimed_shot Fluffy_Pillow 43.4/100: 43% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:10.036 trickshots N steady_shot Fluffy_Pillow 19.7/100: 20% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:11.423 trickshots F steady_shot Fluffy_Pillow 47.9/100: 48% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:12.810 trickshots K multishot Fluffy_Pillow 75.8/100: 76% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:13.996 trickshots I aimed_shot enemy2 67.1/100: 67% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:15.185 trickshots K multishot Fluffy_Pillow 43.4/100: 43% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:16.374 trickshots J rapid_fire Fluffy_Pillow 34.7/100: 35% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:18.231 trickshots K multishot Fluffy_Pillow 54.8/100: 55% focus precise_shots, steady_focus
2:19.421 trickshots I aimed_shot enemy3 42.3/100: 42% focus steady_focus, trick_shots
2:21.399 trickshots N steady_shot Fluffy_Pillow 19.8/100: 20% focus precise_shots, steady_focus
2:22.785 trickshots K multishot Fluffy_Pillow 38.6/100: 39% focus precise_shots, steady_focus
2:23.972 trickshots N steady_shot Fluffy_Pillow 26.1/100: 26% focus steady_focus, trick_shots
2:25.359 trickshots F steady_shot Fluffy_Pillow 44.9/100: 45% focus steady_focus, trick_shots
2:26.745 trickshots I aimed_shot Fluffy_Pillow 63.7/100: 64% focus steady_focus, trick_shots
2:28.723 trickshots K multishot Fluffy_Pillow 41.2/100: 41% focus precise_shots(2), steady_focus
2:29.914 trickshots N steady_shot Fluffy_Pillow 28.7/100: 29% focus precise_shots, steady_focus, trick_shots
2:31.300 trickshots N steady_shot Fluffy_Pillow 47.5/100: 47% focus precise_shots, steady_focus, trick_shots
2:32.686 trickshots K multishot Fluffy_Pillow 66.3/100: 66% focus precise_shots, steady_focus, trick_shots
2:33.875 trickshots I aimed_shot enemy2 53.8/100: 54% focus steady_focus, trick_shots
2:35.853 trickshots K multishot Fluffy_Pillow 31.3/100: 31% focus precise_shots, steady_focus
2:37.041 trickshots J rapid_fire Fluffy_Pillow 18.8/100: 19% focus steady_focus, trick_shots
2:38.795 trickshots K multishot Fluffy_Pillow 36.9/100: 37% focus steady_focus
2:39.983 trickshots N steady_shot Fluffy_Pillow 24.4/100: 24% focus steady_focus, trick_shots
2:41.370 trickshots I aimed_shot enemy3 43.2/100: 43% focus steady_focus, trick_shots
2:43.347 trickshots K multishot Fluffy_Pillow 20.7/100: 21% focus precise_shots(2), steady_focus
2:44.535 trickshots N steady_shot Fluffy_Pillow 8.3/100: 8% focus precise_shots, steady_focus, trick_shots
2:45.921 trickshots F steady_shot Fluffy_Pillow 27.0/100: 27% focus precise_shots, steady_focus, trick_shots
2:47.308 trickshots N steady_shot Fluffy_Pillow 45.8/100: 46% focus precise_shots, steady_focus, trick_shots
2:48.695 trickshots K multishot Fluffy_Pillow 64.6/100: 65% focus precise_shots, steady_focus, trick_shots
2:49.884 trickshots I aimed_shot Fluffy_Pillow 52.1/100: 52% focus steady_focus, trick_shots
2:51.862 trickshots K multishot Fluffy_Pillow 29.6/100: 30% focus precise_shots, steady_focus
2:53.050 trickshots G double_tap Fluffy_Pillow 17.1/100: 17% focus steady_focus, trick_shots
2:54.240 trickshots N steady_shot Fluffy_Pillow 24.7/100: 25% focus double_tap, steady_focus, trick_shots
2:55.627 trickshots N steady_shot Fluffy_Pillow 43.5/100: 43% focus double_tap, steady_focus, trick_shots
2:57.015 trickshots J rapid_fire Fluffy_Pillow 62.2/100: 62% focus double_tap, steady_focus, trick_shots
2:58.943 trickshots K multishot Fluffy_Pillow 88.4/100: 88% focus steady_focus
3:00.130 trickshots I aimed_shot enemy2 76.0/100: 76% focus steady_focus, trick_shots
3:02.108 default 9 use_items Fluffy_Pillow 53.5/100: 53% focus lock_and_load, precise_shots(2), steady_focus
3:02.108 trickshots K multishot Fluffy_Pillow 53.5/100: 53% focus lock_and_load, precise_shots(2), steady_focus
3:03.298 trickshots K multishot Fluffy_Pillow 41.0/100: 41% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:04.487 trickshots I aimed_shot enemy3 28.5/100: 29% focus lock_and_load, steady_focus, trick_shots
3:05.675 trickshots K multishot Fluffy_Pillow 36.1/100: 36% focus precise_shots, steady_focus
3:06.863 trickshots N steady_shot Fluffy_Pillow 23.6/100: 24% focus steady_focus, trick_shots
3:08.249 trickshots F steady_shot Fluffy_Pillow 42.3/100: 42% focus steady_focus, trick_shots
3:09.636 trickshots M multishot Fluffy_Pillow 61.1/100: 61% focus steady_focus, trick_shots
3:10.824 trickshots N steady_shot Fluffy_Pillow 48.6/100: 49% focus steady_focus, trick_shots
3:12.210 trickshots I aimed_shot Fluffy_Pillow 67.4/100: 67% focus steady_focus, trick_shots
3:14.187 trickshots K multishot Fluffy_Pillow 44.9/100: 45% focus precise_shots(2), steady_focus
3:15.373 trickshots N steady_shot Fluffy_Pillow 32.4/100: 32% focus precise_shots, steady_focus, trick_shots
3:16.759 trickshots N steady_shot Fluffy_Pillow 51.2/100: 51% focus precise_shots, steady_focus, trick_shots
3:18.145 trickshots J rapid_fire Fluffy_Pillow 70.0/100: 70% focus precise_shots, steady_focus, trick_shots
3:19.978 trickshots K multishot Fluffy_Pillow 88.6/100: 89% focus precise_shots, steady_focus
3:21.167 trickshots I aimed_shot enemy2 76.1/100: 76% focus steady_focus, trick_shots
3:23.145 trickshots K multishot Fluffy_Pillow 53.6/100: 54% focus precise_shots, steady_focus
3:24.335 trickshots N steady_shot Fluffy_Pillow 41.2/100: 41% focus steady_focus, trick_shots
3:25.720 trickshots M multishot Fluffy_Pillow 59.9/100: 60% focus steady_focus, trick_shots
3:26.907 trickshots N steady_shot Fluffy_Pillow 47.4/100: 47% focus steady_focus, trick_shots
3:28.294 trickshots F steady_shot Fluffy_Pillow 66.2/100: 66% focus steady_focus, trick_shots
3:29.682 trickshots M multishot Fluffy_Pillow 85.0/100: 85% focus steady_focus, trick_shots
3:30.871 trickshots I aimed_shot enemy3 72.5/100: 73% focus steady_focus, trick_shots
3:32.850 trickshots K multishot Fluffy_Pillow 50.1/100: 50% focus precise_shots(2), steady_focus
3:34.037 trickshots N steady_shot Fluffy_Pillow 37.6/100: 38% focus precise_shots, steady_focus, trick_shots
3:35.422 trickshots K multishot Fluffy_Pillow 56.3/100: 56% focus precise_shots, steady_focus, trick_shots
3:36.609 trickshots N steady_shot Fluffy_Pillow 43.8/100: 44% focus steady_focus, trick_shots
3:37.998 trickshots J rapid_fire Fluffy_Pillow 62.6/100: 63% focus steady_focus, trick_shots
3:40.025 trickshots K multishot Fluffy_Pillow 82.5/100: 82% focus steady_focus
3:41.215 trickshots I aimed_shot Fluffy_Pillow 70.0/100: 70% focus steady_focus, trick_shots
3:43.194 trickshots K multishot Fluffy_Pillow 47.5/100: 48% focus precise_shots, steady_focus
3:44.383 trickshots N steady_shot Fluffy_Pillow 35.0/100: 35% focus steady_focus, trick_shots
3:45.770 trickshots F steady_shot Fluffy_Pillow 53.4/100: 53% focus trick_shots
3:47.253 trickshots M multishot Fluffy_Pillow 72.1/100: 72% focus steady_focus, trick_shots
3:48.441 trickshots M multishot Fluffy_Pillow 59.7/100: 60% focus steady_focus, trick_shots
3:49.629 trickshots I aimed_shot enemy2 47.2/100: 47% focus steady_focus, trick_shots
3:51.644 trickshots K multishot Fluffy_Pillow 24.9/100: 25% focus precise_shots(2), steady_focus
3:52.833 trickshots G double_tap Fluffy_Pillow 12.5/100: 12% focus precise_shots, steady_focus, trick_shots
3:54.238 trickshots N steady_shot Fluffy_Pillow 21.4/100: 21% focus double_tap, precise_shots, steady_focus, trick_shots
3:55.624 trickshots N steady_shot Fluffy_Pillow 40.1/100: 40% focus double_tap, precise_shots, steady_focus, trick_shots
3:57.009 trickshots K multishot Fluffy_Pillow 58.9/100: 59% focus double_tap, precise_shots, steady_focus, trick_shots
3:58.198 trickshots I aimed_shot enemy3 46.4/100: 46% focus double_tap, lock_and_load, steady_focus, trick_shots
3:59.388 trickshots K multishot Fluffy_Pillow 54.0/100: 54% focus precise_shots(2), steady_focus
4:00.576 trickshots J rapid_fire Fluffy_Pillow 41.5/100: 41% focus precise_shots, steady_focus, trick_shots
4:02.287 trickshots H trueshot Fluffy_Pillow 59.3/100: 59% focus precise_shots, steady_focus
4:02.287 cds D blood_fury Fluffy_Pillow 59.3/100: 59% focus precise_shots, steady_focus, trueshot
4:02.287 trickshots K multishot Fluffy_Pillow 59.3/100: 59% focus blood_fury, precise_shots, steady_focus, trueshot
4:03.476 trickshots I aimed_shot Fluffy_Pillow 50.6/100: 51% focus blood_fury, steady_focus, trick_shots, trueshot
4:04.664 trickshots K multishot Fluffy_Pillow 26.9/100: 27% focus blood_fury, precise_shots(2), steady_focus, trueshot
4:05.852 trickshots N steady_shot Fluffy_Pillow 18.1/100: 18% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:07.238 trickshots F steady_shot Fluffy_Pillow 46.3/100: 46% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:08.626 trickshots I aimed_shot enemy2 74.5/100: 74% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:09.815 trickshots K multishot Fluffy_Pillow 50.8/100: 51% focus blood_fury, precise_shots(2), steady_focus, trueshot
4:11.002 trickshots I aimed_shot enemy3 42.0/100: 42% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:12.190 trickshots N steady_shot Fluffy_Pillow 18.3/100: 18% focus blood_fury, precise_shots(2), steady_focus, trueshot
4:13.578 trickshots K multishot Fluffy_Pillow 46.5/100: 46% focus blood_fury, precise_shots(2), steady_focus, trueshot
4:14.769 trickshots I aimed_shot Fluffy_Pillow 37.8/100: 38% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:15.956 trickshots N steady_shot Fluffy_Pillow 14.1/100: 14% focus blood_fury, precise_shots(2), steady_focus, trueshot
4:17.343 trickshots K multishot Fluffy_Pillow 37.1/100: 37% focus precise_shots(2), steady_focus
4:18.532 trickshots J rapid_fire Fluffy_Pillow 24.6/100: 25% focus precise_shots, steady_focus, trick_shots
4:20.262 trickshots K multishot Fluffy_Pillow 42.5/100: 43% focus precise_shots, steady_focus
4:21.449 trickshots N steady_shot Fluffy_Pillow 30.0/100: 30% focus steady_focus, trick_shots
4:22.835 trickshots F steady_shot Fluffy_Pillow 48.8/100: 49% focus steady_focus, trick_shots
4:24.221 trickshots I aimed_shot enemy2 67.3/100: 67% focus steady_focus, trick_shots
4:26.198 trickshots K multishot Fluffy_Pillow 44.9/100: 45% focus lock_and_load, precise_shots, steady_focus
4:27.388 trickshots I aimed_shot enemy3 32.4/100: 32% focus lock_and_load, steady_focus, trick_shots
4:28.578 trickshots K multishot Fluffy_Pillow 39.9/100: 40% focus precise_shots(2), steady_focus
4:29.766 trickshots N steady_shot Fluffy_Pillow 27.4/100: 27% focus precise_shots, steady_focus, trick_shots
4:31.155 trickshots L kill_shot Fluffy_Pillow 46.2/100: 46% focus precise_shots, steady_focus, trick_shots
4:32.346 default 9 use_items Fluffy_Pillow 43.8/100: 44% focus precise_shots, steady_focus, trick_shots
4:32.346 trickshots N steady_shot Fluffy_Pillow 43.8/100: 44% focus precise_shots, steady_focus, trick_shots
4:33.731 trickshots K multishot Fluffy_Pillow 62.5/100: 63% focus precise_shots, steady_focus, trick_shots
4:34.919 trickshots N steady_shot Fluffy_Pillow 50.1/100: 50% focus steady_focus, trick_shots
4:36.304 trickshots F steady_shot Fluffy_Pillow 68.8/100: 69% focus steady_focus, trick_shots
4:37.690 trickshots I aimed_shot Fluffy_Pillow 87.6/100: 88% focus steady_focus, trick_shots
4:39.668 trickshots K multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus
4:40.856 trickshots J rapid_fire Fluffy_Pillow 52.5/100: 53% focus steady_focus, trick_shots
4:42.706 trickshots K multishot Fluffy_Pillow 71.3/100: 71% focus steady_focus
4:43.896 trickshots L kill_shot Fluffy_Pillow 58.8/100: 59% focus steady_focus, trick_shots
4:45.087 trickshots I aimed_shot enemy2 56.3/100: 56% focus steady_focus, trick_shots
4:47.133 trickshots K multishot Fluffy_Pillow 34.3/100: 34% focus precise_shots(2), steady_focus
4:48.321 trickshots N steady_shot Fluffy_Pillow 21.8/100: 22% focus precise_shots, steady_focus, trick_shots
4:49.707 trickshots F steady_shot Fluffy_Pillow 40.6/100: 41% focus precise_shots, steady_focus, trick_shots
4:51.093 trickshots K multishot Fluffy_Pillow 59.3/100: 59% focus precise_shots, steady_focus, trick_shots
4:52.283 trickshots N steady_shot Fluffy_Pillow 46.9/100: 47% focus steady_focus, trick_shots
4:53.668 trickshots G double_tap Fluffy_Pillow 65.6/100: 66% focus steady_focus, trick_shots
4:54.856 trickshots I aimed_shot enemy3 73.2/100: 73% focus double_tap, steady_focus, trick_shots
4:56.835 trickshots K multishot Fluffy_Pillow 50.7/100: 51% focus precise_shots, steady_focus
4:58.025 trickshots L kill_shot Fluffy_Pillow 38.2/100: 38% focus steady_focus, trick_shots
4:59.215 trickshots N steady_shot Fluffy_Pillow 35.7/100: 36% focus steady_focus, trick_shots
5:00.602 trickshots N steady_shot Fluffy_Pillow 54.5/100: 55% focus steady_focus, trick_shots
5:01.990 trickshots J rapid_fire Fluffy_Pillow 73.3/100: 73% focus steady_focus, trick_shots
5:03.663 trickshots K multishot Fluffy_Pillow 90.9/100: 91% focus steady_focus
5:04.851 trickshots I aimed_shot Fluffy_Pillow 78.4/100: 78% focus steady_focus, trick_shots
5:06.829 trickshots K multishot Fluffy_Pillow 55.9/100: 56% focus precise_shots, steady_focus
5:08.016 trickshots L kill_shot Fluffy_Pillow 43.4/100: 43% focus steady_focus, trick_shots
5:09.212 trickshots N steady_shot Fluffy_Pillow 41.0/100: 41% focus steady_focus, trick_shots
5:10.598 trickshots M multishot Fluffy_Pillow 59.8/100: 60% focus steady_focus, trick_shots
5:11.786 trickshots N steady_shot Fluffy_Pillow 47.3/100: 47% focus steady_focus, trick_shots
5:13.172 cds E potion Fluffy_Pillow 66.1/100: 66% focus steady_focus, trick_shots
5:13.172 trickshots F steady_shot Fluffy_Pillow 66.1/100: 66% focus steady_focus, trick_shots, potion_of_spectral_agility
5:14.559 trickshots I aimed_shot enemy2 84.9/100: 85% focus steady_focus, trick_shots, potion_of_spectral_agility
5:16.537 trickshots K multishot Fluffy_Pillow 62.4/100: 62% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:17.726 trickshots N steady_shot Fluffy_Pillow 49.9/100: 50% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:19.111 trickshots K multishot Fluffy_Pillow 68.7/100: 69% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:20.300 trickshots L kill_shot Fluffy_Pillow 56.2/100: 56% focus steady_focus, trick_shots, potion_of_spectral_agility
5:21.489 trickshots I aimed_shot enemy3 53.7/100: 54% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:22.677 trickshots K multishot Fluffy_Pillow 61.2/100: 61% focus precise_shots, steady_focus, potion_of_spectral_agility
5:23.863 trickshots I aimed_shot Fluffy_Pillow 48.7/100: 49% focus steady_focus, trick_shots, potion_of_spectral_agility
5:25.842 trickshots K multishot Fluffy_Pillow 26.3/100: 26% focus precise_shots, steady_focus, potion_of_spectral_agility
5:27.030 trickshots J rapid_fire Fluffy_Pillow 13.8/100: 14% focus steady_focus, trick_shots, potion_of_spectral_agility
5:28.828 trickshots K multishot Fluffy_Pillow 32.2/100: 32% focus steady_focus, potion_of_spectral_agility
5:30.017 trickshots N steady_shot Fluffy_Pillow 19.5/100: 20% focus trick_shots, potion_of_spectral_agility
5:31.501 trickshots F steady_shot Fluffy_Pillow 38.3/100: 38% focus trick_shots, potion_of_spectral_agility
5:32.985 trickshots I aimed_shot enemy2 57.1/100: 57% focus steady_focus, trick_shots, potion_of_spectral_agility
5:34.962 trickshots K multishot Fluffy_Pillow 34.6/100: 35% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:36.152 trickshots L kill_shot Fluffy_Pillow 22.1/100: 22% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:37.340 trickshots N steady_shot Fluffy_Pillow 19.6/100: 20% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:38.727 trickshots N steady_shot Fluffy_Pillow 38.4/100: 38% focus precise_shots, steady_focus, trick_shots

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Serpentstalker's Trickery }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="marksmanship"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7013,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

no_lego : 7254 dps, 3710 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
7254.3 7254.3 11.9 / 0.165% 842.3 / 11.6% 715.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.1 9.9 Focus 0.00% 47.4 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
no_lego 7254
Aimed Shot 2464 (2709) 34.0% (37.3%) 47.8 6.26sec 17034 11018 Direct 143.1 (157.0) 4220 8428 5174 22.7% (22.6%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.77 143.15 0.00 0.00 1.5461 0.0000 740593.82 1057864.21 29.99% 11017.63 11017.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.35% 110.73 75 149 4220.44 2524 9967 4222.97 3869 4533 467301 667492 29.99%
crit 22.65% 32.42 16 55 8427.93 5048 19934 8435.49 6546 10621 273293 390372 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:47.95
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 244 3.4% 0.0 0.00sec 0 0 Direct 13.8 4332 8638 5292 22.3%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.82 0.00 0.00 0.0000 0.0000 73135.02 104466.06 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.72% 10.74 1 18 4332.36 2524 9967 4368.48 2990 7052 46526 66457 29.99%
crit 22.28% 3.08 0 10 8638.42 5048 19934 8286.23 0 19934 26609 38009 28.54%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 373 5.2% 113.0 2.67sec 994 438 Direct 112.8 812 1624 996 22.7%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.04 112.81 0.00 0.00 2.2691 0.0000 112343.96 160472.11 29.99% 438.00 438.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.30% 87.20 61 115 811.54 774 1019 811.44 796 825 70763 101078 29.99%
crit 22.70% 25.61 9 42 1623.57 1548 2037 1623.60 1558 1723 41581 59394 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 138 1.9% 3.8 90.72sec 11024 0 Direct 3.7 9058 18099 11048 22.1%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.75 3.74 0.00 0.00 0.0000 0.0000 41387.45 41387.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.89% 2.92 0 4 9057.95 8937 9474 9032.07 0 9474 26408 26408 0.00%
crit 22.11% 0.83 0 4 18099.05 17875 18947 10996.42 0 18947 14980 14980 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.6% 21.9 13.39sec 548 0 Direct 21.9 446 893 549 22.9%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.91 21.91 0.00 0.00 0.0000 0.0000 12015.51 12015.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.11% 16.89 7 29 446.26 435 485 446.22 435 459 7539 7539 0.00%
crit 22.89% 5.01 0 12 892.94 871 969 888.13 0 946 4477 4477 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 83 1.1% 4.6 13.67sec 5438 4555 Direct 4.6 4259 9601 5478 22.9%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.59 4.55 0.00 0.00 1.1940 0.0000 24961.55 35655.07 29.99% 4555.03 4555.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.15% 3.51 0 7 4259.20 4065 4838 4247.53 0 4838 14968 21380 29.95%
crit 22.85% 1.04 0 4 9600.51 9146 10885 6491.79 0 10885 9993 14275 20.29%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:4.59
  • if_expr:buff.dead_eye.down
Master Marksman 322 4.4% 189.3 1.59sec 511 0 Periodic 321.0 301 0 301 0.0% 71.1%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.32 0.00 320.95 320.95 0.0000 2.0000 96729.87 96729.87 0.00% 150.69 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 320.95 232 412 301.36 37 2703 301.40 220 392 96730 96730 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 1622 22.4% 81.8 3.66sec 5961 5225 Direct 244.9 1626 3247 1991 22.6%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 81.80 244.87 0.00 0.00 1.1409 0.0000 487639.11 696543.71 29.99% 5225.06 5225.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.44% 189.64 139 241 1625.93 953 2194 1625.75 1513 1732 308321 440406 29.99%
crit 22.56% 55.23 32 83 3246.70 1905 4389 3245.93 2821 3529 179318 256138 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:74.31
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:7.48
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 731 10.1% 16.4 18.39sec 13387 7621 Periodic 361.9 495 989 607 22.7% 2.7%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.41 0.00 121.03 361.91 1.7566 0.2039 219694.07 313811.01 29.99% 7621.12 7621.12
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.28% 279.68 180 395 494.86 351 925 494.91 474 513 138400 197691 29.99%
crit 22.72% 82.23 43 126 988.50 703 1850 988.59 849 1122 81294 116120 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:16.41
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.6% 44.1 6.72sec 301 0 Direct 44.1 245 491 301 22.7%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.12 44.12 0.00 0.00 0.0000 0.0000 13284.29 13284.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.31% 34.11 17 55 245.46 239 266 245.46 242 251 8373 8373 0.00%
crit 22.69% 10.01 1 20 490.68 479 533 490.70 479 508 4911 4911 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 349 4.8% 66.7 4.48sec 1574 1168 Direct 67.6 1266 2533 1553 22.7%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.73 67.62 0.00 0.00 1.3478 0.0000 105023.04 150014.92 29.99% 1167.64 1167.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.34% 52.30 34 73 1265.99 1219 1605 1265.70 1234 1294 66209 94574 29.99%
crit 22.66% 15.33 4 30 2532.56 2439 3210 2531.76 2439 2677 38814 55441 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.31
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:50.69
Wild Spirits 30 (845) 0.4% (11.6%) 3.0 120.62sec 84706 77085 Direct 8.9 (140.5) 810 1621 988 21.9% (22.6%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 8.91 0.00 0.00 1.0989 0.0000 8797.06 8797.06 0.00% 77085.33 77085.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.13% 6.96 2 9 809.94 776 910 810.05 776 858 5638 5638 0.00%
crit 21.87% 1.95 0 7 1621.34 1552 1820 1426.25 0 1820 3160 3160 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 815 11.2% 43.9 5.84sec 5554 0 Direct 131.6 1509 3018 1851 22.7%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.87 131.61 0.00 0.00 0.0000 0.0000 243657.40 243657.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.31% 101.76 64 124 1508.93 1355 1699 1509.49 1485 1554 153544 153544 0.00%
crit 22.69% 29.86 12 48 3017.96 2711 3398 3019.08 2907 3130 90114 90114 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
no_lego
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.75sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.98
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.62sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 0.00 0.00 0.00 0.9781 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.63
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 308.90sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.48
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.76sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.63% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.63%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.5sec 60.6sec 4.5sec 8.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.4s

Stack Uptimes

  • double_tap_1:8.36%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.8 0.2 30.7sec 30.0sec 1.9sec 5.44% 18.13% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 246.2s
  • trigger_min/max:1.8s / 246.2s
  • trigger_pct:8.00%
  • duration_min/max:0.0s / 11.5s

Stack Uptimes

  • lock_and_load_1:5.44%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.0sec 309.0sec 23.1sec 11.18% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.8s
  • trigger_min/max:300.0s / 332.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.18%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.3 7.5 7.4sec 6.3sec 2.9sec 38.63% 82.37% 3.7 (3.7) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 36.9s
  • trigger_min/max:0.9s / 13.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 31.0s

Stack Uptimes

  • precise_shots_1:33.22%
  • precise_shots_2:5.41%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 6.2 18.7 51.9sec 12.2sec 46.1sec 94.39% 0.00% 18.7 (18.7) 5.2

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 268.8s
  • trigger_min/max:4.0s / 38.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 267.8s

Stack Uptimes

  • steady_focus_1:94.39%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 65.0 16.8 4.6sec 3.7sec 4.1sec 88.74% 100.00% 16.8 (16.8) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.4s
  • trigger_min/max:0.9s / 11.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:88.74%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.1sec 19.00% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • trueshot_1:19.00%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.6sec 17.45% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.45%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.6 1.0 7.0 69.0s 47.1s 295.3s
double_tap_rapid_fire 0.9 0.0 5.0 93.1s 55.1s 297.9s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.87% 0.68% 1.69% 0.9s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7410.0012.7012.8170.0607.523
Aimed Shot1.2730.0016.84513.6144.00429.241
Kill Shot3.8730.00122.77212.9030.32931.129
Wild Spirits0.7690.0012.6881.2980.0004.533
Trueshot0.8360.0012.9601.5670.2714.810
Rapid Fire3.1220.00126.00742.40314.97872.764

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
no_lego
steady_shot Focus 67.73 657.31 22.04% 9.70 20.03 2.96%
rapid_fire Focus 121.01 120.82 4.05% 1.00 0.19 0.16%
focus_regen Focus 610.88 1951.20 65.43% 3.19 19.33 0.98%
Trueshot Focus 191.89 252.95 8.48% 1.32 0.96 0.38%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.91 10.12 40.5 35.9 0.2 95.7
Usage Type Count Total Avg RPE APR
no_lego
aimed_shot Focus 47.8 1364.6 28.6 28.6 596.3
kill_shot Focus 4.6 45.9 10.0 10.0 544.1
multishot Focus 81.8 1635.8 20.0 20.0 298.1

Statistics & Data Analysis

Fight Length
no_lego Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
no_lego Damage Per Second
Count 1323
Mean 7254.32
Minimum 6539.18
Maximum 8024.11
Spread ( max - min ) 1484.93
Range [ ( max - min ) / 2 * 100% ] 10.23%
Standard Deviation 221.6683
5th Percentile 6906.70
95th Percentile 7627.74
( 95th Percentile - 5th Percentile ) 721.04
Mean Distribution
Standard Deviation 6.0943
95.00% Confidence Interval ( 7242.37 - 7266.26 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3587
0.1 Scale Factor Error with Delta=300 420
0.05 Scale Factor Error with Delta=300 1678
0.01 Scale Factor Error with Delta=300 41947
Priority Target DPS
no_lego Priority Target Damage Per Second
Count 1323
Mean 3709.96
Minimum 3364.45
Maximum 4213.63
Spread ( max - min ) 849.19
Range [ ( max - min ) / 2 * 100% ] 11.44%
Standard Deviation 124.1361
5th Percentile 3511.38
95th Percentile 3917.15
( 95th Percentile - 5th Percentile ) 405.77
Mean Distribution
Standard Deviation 3.4129
95.00% Confidence Interval ( 3703.27 - 3716.65 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4301
0.1 Scale Factor Error with Delta=300 132
0.05 Scale Factor Error with Delta=300 527
0.01 Scale Factor Error with Delta=300 13155
DPS(e)
no_lego Damage Per Second (Effective)
Count 1323
Mean 7254.32
Minimum 6539.18
Maximum 8024.11
Spread ( max - min ) 1484.93
Range [ ( max - min ) / 2 * 100% ] 10.23%
Damage
no_lego Damage
Count 1323
Mean 2179262.15
Minimum 1642911.04
Maximum 2646677.33
Spread ( max - min ) 1003766.29
Range [ ( max - min ) / 2 * 100% ] 23.03%
DTPS
no_lego Damage Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
no_lego Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
no_lego Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
no_lego Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
no_lego Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
no_lego Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
no_legoTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
no_lego Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.76 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.98 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.48 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.31 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.63 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 47.95 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 16.41 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 74.31 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 4.59 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 7.48 multishot,if=focus>cost+action.aimed_shot.cost
O 50.69 steady_shot

Sample Sequence

0125789FHIDELJLJLKLJLOFJLJOLKLJLOOJLOJOLKLOFJLOOLJLOOLOGJLKLOFJLOLONNJLOFKLJLJLOLJLO9FOLJLKLOFJLOONGJLOOJLJLHIDJLJLJLJOFLJLKLJLJLOFKLJLOJOFLOJLOOKGLJLJLO9FLNJLJLJOFLKLJLOOOLJLJLOOKLJLOONONJLOGOFKLJLHIDJLJLKLJLKLJOFLJLKLOJ9LJLOFJLMJOLKLJLMGOFJLOMOLJLKLMEOFJLJLOLJLMOFJLKLMO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask no_lego 100.0/100: 100% focus
Pre precombat 1 augmentation no_lego 100.0/100: 100% focus
Pre precombat 2 food no_lego 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.481 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.398 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.398 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.398 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.398 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.312 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.228 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.142 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.056 trickshots L multishot Fluffy_Pillow 34.5/100: 34% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.972 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:08.451 trickshots L multishot Fluffy_Pillow 54.1/100: 54% focus bloodlust, blood_fury, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:09.368 trickshots J aimed_shot Fluffy_Pillow 45.4/100: 45% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.282 trickshots L multishot Fluffy_Pillow 21.7/100: 22% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.197 trickshots O steady_shot Fluffy_Pillow 12.9/100: 13% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.264 trickshots F steady_shot Fluffy_Pillow 41.1/100: 41% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:13.331 trickshots J aimed_shot Fluffy_Pillow 69.3/100: 69% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.248 trickshots L multishot Fluffy_Pillow 45.6/100: 46% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:15.164 trickshots J aimed_shot Fluffy_Pillow 36.9/100: 37% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:16.079 trickshots O steady_shot Fluffy_Pillow 13.2/100: 13% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:17.145 trickshots L multishot Fluffy_Pillow 41.4/100: 41% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:18.060 trickshots K rapid_fire Fluffy_Pillow 32.7/100: 33% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:19.485 trickshots L multishot Fluffy_Pillow 57.2/100: 57% focus bloodlust, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:20.401 trickshots J aimed_shot Fluffy_Pillow 48.5/100: 49% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:21.316 trickshots L multishot Fluffy_Pillow 24.8/100: 25% focus bloodlust, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:22.229 trickshots O steady_shot Fluffy_Pillow 15.4/100: 15% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:23.296 trickshots O steady_shot Fluffy_Pillow 34.1/100: 34% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:24.364 trickshots J aimed_shot Fluffy_Pillow 52.9/100: 53% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:25.889 trickshots L multishot Fluffy_Pillow 30.5/100: 30% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:26.804 trickshots O steady_shot Fluffy_Pillow 18.0/100: 18% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:27.872 trickshots J aimed_shot Fluffy_Pillow 36.8/100: 37% focus bloodlust, steady_focus, trick_shots
0:29.396 trickshots O steady_shot Fluffy_Pillow 14.3/100: 14% focus bloodlust, precise_shots, steady_focus
0:30.463 trickshots L multishot Fluffy_Pillow 33.1/100: 33% focus bloodlust, precise_shots, steady_focus
0:31.380 trickshots K rapid_fire Fluffy_Pillow 20.7/100: 21% focus bloodlust, steady_focus, trick_shots
0:32.864 trickshots L multishot Fluffy_Pillow 39.9/100: 40% focus bloodlust, steady_focus
0:33.780 trickshots O steady_shot Fluffy_Pillow 27.4/100: 27% focus bloodlust, steady_focus, trick_shots
0:34.846 trickshots F steady_shot Fluffy_Pillow 46.2/100: 46% focus bloodlust, steady_focus, trick_shots
0:35.915 trickshots J aimed_shot Fluffy_Pillow 65.0/100: 65% focus bloodlust, steady_focus, trick_shots
0:37.439 trickshots L multishot Fluffy_Pillow 42.5/100: 43% focus bloodlust, precise_shots(2), steady_focus
0:38.355 trickshots O steady_shot Fluffy_Pillow 30.0/100: 30% focus bloodlust, precise_shots, steady_focus, trick_shots
0:39.423 trickshots O steady_shot Fluffy_Pillow 48.8/100: 49% focus bloodlust, precise_shots, steady_focus, trick_shots
0:40.490 trickshots L multishot Fluffy_Pillow 67.6/100: 68% focus bloodlust, precise_shots, steady_focus, trick_shots
0:41.407 trickshots J aimed_shot Fluffy_Pillow 54.4/100: 54% focus steady_focus, trick_shots
0:43.384 trickshots L multishot Fluffy_Pillow 31.9/100: 32% focus precise_shots(2), steady_focus
0:44.572 trickshots O steady_shot Fluffy_Pillow 19.4/100: 19% focus precise_shots, steady_focus, trick_shots
0:45.956 trickshots O steady_shot Fluffy_Pillow 38.2/100: 38% focus precise_shots, steady_focus, trick_shots
0:47.344 trickshots L multishot Fluffy_Pillow 57.0/100: 57% focus precise_shots, steady_focus, trick_shots
0:48.533 trickshots O steady_shot Fluffy_Pillow 44.5/100: 44% focus steady_focus, trick_shots
0:49.918 trickshots G double_tap Fluffy_Pillow 63.3/100: 63% focus steady_focus, trick_shots
0:51.188 trickshots J aimed_shot Fluffy_Pillow 71.3/100: 71% focus double_tap, steady_focus, trick_shots
0:53.167 trickshots L multishot Fluffy_Pillow 48.8/100: 49% focus precise_shots, steady_focus
0:54.357 trickshots K rapid_fire Fluffy_Pillow 36.3/100: 36% focus steady_focus, trick_shots
0:56.223 trickshots L multishot Fluffy_Pillow 55.2/100: 55% focus steady_focus
0:57.413 trickshots O steady_shot Fluffy_Pillow 42.7/100: 43% focus steady_focus, trick_shots
0:58.801 trickshots F steady_shot Fluffy_Pillow 61.5/100: 61% focus steady_focus, trick_shots
1:00.189 trickshots J aimed_shot Fluffy_Pillow 80.3/100: 80% focus steady_focus, trick_shots
1:02.166 trickshots L multishot Fluffy_Pillow 57.8/100: 58% focus precise_shots(2), steady_focus
1:03.354 trickshots O steady_shot Fluffy_Pillow 45.3/100: 45% focus precise_shots, steady_focus, trick_shots
1:04.741 trickshots L multishot Fluffy_Pillow 64.1/100: 64% focus precise_shots, steady_focus, trick_shots
1:05.928 trickshots O steady_shot Fluffy_Pillow 51.6/100: 52% focus steady_focus, trick_shots
1:07.313 trickshots N multishot Fluffy_Pillow 70.3/100: 70% focus steady_focus, trick_shots
1:08.503 trickshots N multishot Fluffy_Pillow 57.9/100: 58% focus steady_focus, trick_shots
1:09.691 trickshots J aimed_shot Fluffy_Pillow 45.4/100: 45% focus steady_focus, trick_shots
1:11.669 trickshots L multishot Fluffy_Pillow 22.9/100: 23% focus precise_shots(2), steady_focus
1:12.859 trickshots O steady_shot Fluffy_Pillow 10.5/100: 10% focus precise_shots, steady_focus, trick_shots
1:14.246 trickshots F steady_shot Fluffy_Pillow 29.2/100: 29% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:15.633 trickshots K rapid_fire Fluffy_Pillow 47.8/100: 48% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:17.468 trickshots L multishot Fluffy_Pillow 66.4/100: 66% focus lock_and_load, precise_shots, steady_focus
1:18.655 trickshots J aimed_shot Fluffy_Pillow 54.0/100: 54% focus lock_and_load, steady_focus, trick_shots
1:19.844 trickshots L multishot Fluffy_Pillow 61.5/100: 61% focus precise_shots, steady_focus
1:21.033 trickshots J aimed_shot Fluffy_Pillow 49.0/100: 49% focus steady_focus, trick_shots
1:23.012 trickshots L multishot Fluffy_Pillow 26.5/100: 27% focus lock_and_load, precise_shots(2), steady_focus
1:24.201 trickshots O steady_shot Fluffy_Pillow 14.1/100: 14% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:25.589 trickshots L multishot Fluffy_Pillow 32.8/100: 33% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:26.778 trickshots J aimed_shot Fluffy_Pillow 20.4/100: 20% focus lock_and_load, steady_focus, trick_shots
1:27.968 trickshots L multishot Fluffy_Pillow 27.9/100: 28% focus precise_shots(2), steady_focus
1:29.154 trickshots O steady_shot Fluffy_Pillow 15.4/100: 15% focus precise_shots, steady_focus, trick_shots
1:30.540 default 9 use_items Fluffy_Pillow 34.2/100: 34% focus precise_shots, steady_focus, trick_shots
1:30.540 trickshots F steady_shot Fluffy_Pillow 34.2/100: 34% focus precise_shots, steady_focus, trick_shots
1:31.924 trickshots O steady_shot Fluffy_Pillow 52.4/100: 52% focus precise_shots, steady_focus, trick_shots
1:33.310 trickshots L multishot Fluffy_Pillow 71.2/100: 71% focus precise_shots, steady_focus, trick_shots
1:34.499 trickshots J aimed_shot Fluffy_Pillow 58.7/100: 59% focus steady_focus, trick_shots
1:36.477 trickshots L multishot Fluffy_Pillow 36.2/100: 36% focus precise_shots, steady_focus
1:37.664 trickshots K rapid_fire Fluffy_Pillow 23.7/100: 24% focus steady_focus, trick_shots
1:39.444 trickshots L multishot Fluffy_Pillow 42.0/100: 42% focus steady_focus
1:40.632 trickshots O steady_shot Fluffy_Pillow 29.5/100: 30% focus steady_focus, trick_shots
1:42.020 trickshots F steady_shot Fluffy_Pillow 48.3/100: 48% focus steady_focus, trick_shots
1:43.406 trickshots J aimed_shot Fluffy_Pillow 67.1/100: 67% focus steady_focus, trick_shots
1:45.383 trickshots L multishot Fluffy_Pillow 44.6/100: 45% focus precise_shots, steady_focus
1:46.572 trickshots O steady_shot Fluffy_Pillow 32.1/100: 32% focus steady_focus, trick_shots
1:47.956 trickshots O steady_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus, trick_shots
1:49.341 trickshots N multishot Fluffy_Pillow 69.6/100: 70% focus steady_focus, trick_shots
1:50.529 trickshots G double_tap Fluffy_Pillow 57.2/100: 57% focus steady_focus, trick_shots
1:51.718 trickshots J aimed_shot Fluffy_Pillow 64.7/100: 65% focus double_tap, steady_focus, trick_shots
1:53.697 trickshots L multishot Fluffy_Pillow 42.2/100: 42% focus precise_shots, steady_focus
1:54.884 trickshots O steady_shot Fluffy_Pillow 29.7/100: 30% focus steady_focus, trick_shots
1:56.271 trickshots O steady_shot Fluffy_Pillow 48.5/100: 48% focus steady_focus, trick_shots
1:57.655 trickshots J aimed_shot Fluffy_Pillow 67.3/100: 67% focus lock_and_load, steady_focus, trick_shots
1:58.844 trickshots L multishot Fluffy_Pillow 74.8/100: 75% focus lock_and_load, precise_shots, steady_focus
2:00.033 trickshots J aimed_shot Fluffy_Pillow 62.3/100: 62% focus lock_and_load, steady_focus, trick_shots
2:01.222 trickshots L multishot Fluffy_Pillow 69.8/100: 70% focus lock_and_load, precise_shots(2), steady_focus
2:02.409 trickshots H wild_spirits Fluffy_Pillow 57.3/100: 57% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:03.597 trickshots I trueshot Fluffy_Pillow 64.9/100: 65% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:03.597 cds D blood_fury Fluffy_Pillow 64.9/100: 65% focus lock_and_load, precise_shots, steady_focus, trick_shots, trueshot
2:03.597 trickshots J aimed_shot Fluffy_Pillow 64.9/100: 65% focus blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot
2:04.787 trickshots L multishot Fluffy_Pillow 76.2/100: 76% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:05.976 trickshots J aimed_shot Fluffy_Pillow 67.4/100: 67% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:07.167 trickshots L multishot Fluffy_Pillow 43.8/100: 44% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:08.356 trickshots J aimed_shot Fluffy_Pillow 35.0/100: 35% focus blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:09.543 trickshots L multishot Fluffy_Pillow 46.3/100: 46% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:10.731 trickshots J aimed_shot Fluffy_Pillow 37.6/100: 38% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:11.920 trickshots O steady_shot Fluffy_Pillow 13.9/100: 14% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:13.307 trickshots F steady_shot Fluffy_Pillow 41.6/100: 42% focus blood_fury, precise_shots(2), trueshot, wild_spirits
2:14.789 trickshots L multishot Fluffy_Pillow 69.8/100: 70% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:15.977 trickshots J aimed_shot Fluffy_Pillow 61.1/100: 61% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:17.165 trickshots L multishot Fluffy_Pillow 37.3/100: 37% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:18.352 trickshots K rapid_fire Fluffy_Pillow 28.6/100: 29% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:20.113 trickshots L multishot Fluffy_Pillow 57.3/100: 57% focus precise_shots, steady_focus, trueshot, wild_spirits
2:21.303 trickshots J aimed_shot Fluffy_Pillow 48.6/100: 49% focus steady_focus, trick_shots, trueshot, wild_spirits
2:22.490 trickshots L multishot Fluffy_Pillow 24.9/100: 25% focus precise_shots(2), steady_focus, trueshot
2:23.679 trickshots J aimed_shot Fluffy_Pillow 14.8/100: 15% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:24.869 trickshots L multishot Fluffy_Pillow 22.4/100: 22% focus precise_shots(2), steady_focus
2:26.058 trickshots O steady_shot Fluffy_Pillow 9.9/100: 10% focus precise_shots, steady_focus, trick_shots
2:27.442 trickshots F steady_shot Fluffy_Pillow 28.6/100: 29% focus precise_shots, steady_focus, trick_shots
2:28.828 trickshots K rapid_fire Fluffy_Pillow 47.4/100: 47% focus precise_shots, steady_focus, trick_shots
2:30.743 trickshots L multishot Fluffy_Pillow 66.5/100: 67% focus precise_shots, steady_focus
2:31.931 trickshots J aimed_shot Fluffy_Pillow 54.1/100: 54% focus steady_focus, trick_shots
2:33.909 trickshots L multishot Fluffy_Pillow 31.6/100: 32% focus precise_shots, steady_focus
2:35.095 trickshots O steady_shot Fluffy_Pillow 19.1/100: 19% focus steady_focus, trick_shots
2:36.481 trickshots J aimed_shot Fluffy_Pillow 37.9/100: 38% focus steady_focus, trick_shots
2:38.459 trickshots O steady_shot Fluffy_Pillow 15.4/100: 15% focus precise_shots, steady_focus
2:39.846 trickshots F steady_shot Fluffy_Pillow 34.1/100: 34% focus precise_shots, steady_focus
2:41.231 trickshots L multishot Fluffy_Pillow 52.9/100: 53% focus precise_shots, steady_focus
2:42.419 trickshots O steady_shot Fluffy_Pillow 40.4/100: 40% focus steady_focus, trick_shots
2:43.806 trickshots J aimed_shot Fluffy_Pillow 59.2/100: 59% focus steady_focus, trick_shots
2:45.785 trickshots L multishot Fluffy_Pillow 36.7/100: 37% focus precise_shots(2), steady_focus
2:46.974 trickshots O steady_shot Fluffy_Pillow 24.3/100: 24% focus precise_shots, steady_focus, trick_shots
2:48.360 trickshots O steady_shot Fluffy_Pillow 43.0/100: 43% focus precise_shots, steady_focus, trick_shots
2:49.745 trickshots K rapid_fire Fluffy_Pillow 61.8/100: 62% focus precise_shots, steady_focus, trick_shots
2:51.520 trickshots G double_tap Fluffy_Pillow 80.0/100: 80% focus precise_shots, steady_focus
2:52.708 trickshots L multishot Fluffy_Pillow 87.6/100: 88% focus double_tap, precise_shots, steady_focus
2:53.896 trickshots J aimed_shot Fluffy_Pillow 75.1/100: 75% focus double_tap, steady_focus, trick_shots
2:55.875 trickshots L multishot Fluffy_Pillow 52.6/100: 53% focus lock_and_load, precise_shots, steady_focus
2:57.062 trickshots J aimed_shot Fluffy_Pillow 40.1/100: 40% focus lock_and_load, steady_focus, trick_shots
2:58.249 trickshots L multishot Fluffy_Pillow 47.6/100: 48% focus precise_shots(2), steady_focus
2:59.439 trickshots O steady_shot Fluffy_Pillow 35.2/100: 35% focus precise_shots, steady_focus, trick_shots
3:00.826 default 9 use_items Fluffy_Pillow 53.9/100: 54% focus precise_shots, steady_focus, trick_shots
3:00.826 trickshots F steady_shot Fluffy_Pillow 53.9/100: 54% focus precise_shots, steady_focus, trick_shots
3:02.211 trickshots L multishot Fluffy_Pillow 72.7/100: 73% focus precise_shots, steady_focus, trick_shots
3:03.400 trickshots N multishot Fluffy_Pillow 60.2/100: 60% focus steady_focus, trick_shots
3:04.587 trickshots J aimed_shot Fluffy_Pillow 47.7/100: 48% focus lock_and_load, steady_focus, trick_shots
3:05.777 trickshots L multishot Fluffy_Pillow 55.3/100: 55% focus precise_shots, steady_focus
3:06.966 trickshots J aimed_shot Fluffy_Pillow 42.8/100: 43% focus lock_and_load, steady_focus, trick_shots
3:08.153 trickshots L multishot Fluffy_Pillow 50.3/100: 50% focus precise_shots, steady_focus
3:09.342 trickshots J aimed_shot Fluffy_Pillow 37.8/100: 38% focus steady_focus, trick_shots
3:11.321 trickshots O steady_shot Fluffy_Pillow 15.4/100: 15% focus precise_shots(2), steady_focus
3:12.710 trickshots F steady_shot Fluffy_Pillow 34.2/100: 34% focus precise_shots(2), steady_focus
3:14.098 trickshots L multishot Fluffy_Pillow 52.9/100: 53% focus precise_shots(2), steady_focus
3:15.286 trickshots K rapid_fire Fluffy_Pillow 40.5/100: 40% focus precise_shots, steady_focus, trick_shots
3:17.151 trickshots L multishot Fluffy_Pillow 59.3/100: 59% focus precise_shots, steady_focus
3:18.339 trickshots J aimed_shot Fluffy_Pillow 46.8/100: 47% focus steady_focus, trick_shots
3:20.319 trickshots L multishot Fluffy_Pillow 24.3/100: 24% focus precise_shots(2), steady_focus
3:21.509 trickshots O steady_shot Fluffy_Pillow 11.8/100: 12% focus precise_shots, steady_focus, trick_shots
3:22.895 trickshots O steady_shot Fluffy_Pillow 30.6/100: 31% focus precise_shots, steady_focus, trick_shots
3:24.280 trickshots O steady_shot Fluffy_Pillow 49.4/100: 49% focus precise_shots, steady_focus, trick_shots
3:25.667 trickshots L multishot Fluffy_Pillow 68.2/100: 68% focus precise_shots, steady_focus, trick_shots
3:26.855 trickshots J aimed_shot Fluffy_Pillow 55.7/100: 56% focus steady_focus, trick_shots
3:28.834 trickshots L multishot Fluffy_Pillow 33.2/100: 33% focus lock_and_load, precise_shots, steady_focus
3:30.022 trickshots J aimed_shot Fluffy_Pillow 20.7/100: 21% focus lock_and_load, steady_focus, trick_shots
3:31.210 trickshots L multishot Fluffy_Pillow 28.2/100: 28% focus precise_shots(2), steady_focus
3:32.402 trickshots O steady_shot Fluffy_Pillow 15.8/100: 16% focus precise_shots, steady_focus, trick_shots
3:33.788 trickshots O steady_shot Fluffy_Pillow 34.6/100: 35% focus precise_shots, steady_focus, trick_shots
3:35.174 trickshots K rapid_fire Fluffy_Pillow 53.3/100: 53% focus precise_shots, steady_focus, trick_shots
3:37.099 trickshots L multishot Fluffy_Pillow 72.5/100: 73% focus precise_shots, steady_focus
3:38.285 trickshots J aimed_shot Fluffy_Pillow 60.0/100: 60% focus steady_focus, trick_shots
3:40.289 trickshots L multishot Fluffy_Pillow 37.7/100: 38% focus precise_shots, steady_focus
3:41.478 trickshots O steady_shot Fluffy_Pillow 25.2/100: 25% focus steady_focus, trick_shots
3:42.863 trickshots O steady_shot Fluffy_Pillow 44.0/100: 44% focus steady_focus, trick_shots
3:44.250 trickshots N multishot Fluffy_Pillow 62.8/100: 63% focus steady_focus, trick_shots
3:45.438 trickshots O steady_shot Fluffy_Pillow 50.3/100: 50% focus steady_focus, trick_shots
3:46.826 trickshots N multishot Fluffy_Pillow 69.1/100: 69% focus steady_focus, trick_shots
3:48.014 trickshots J aimed_shot Fluffy_Pillow 56.6/100: 57% focus steady_focus, trick_shots
3:49.993 trickshots L multishot Fluffy_Pillow 34.1/100: 34% focus precise_shots, steady_focus
3:51.183 trickshots O steady_shot Fluffy_Pillow 21.7/100: 22% focus steady_focus, trick_shots
3:52.571 trickshots G double_tap Fluffy_Pillow 40.4/100: 40% focus steady_focus, trick_shots
3:53.761 trickshots O steady_shot Fluffy_Pillow 48.0/100: 48% focus double_tap, steady_focus, trick_shots
3:55.147 trickshots F steady_shot Fluffy_Pillow 66.7/100: 67% focus double_tap, steady_focus, trick_shots
3:56.534 trickshots K rapid_fire Fluffy_Pillow 85.5/100: 86% focus double_tap, steady_focus, trick_shots
3:58.495 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus steady_focus
3:59.683 trickshots J aimed_shot Fluffy_Pillow 87.5/100: 88% focus steady_focus, trick_shots
4:01.660 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus lock_and_load, precise_shots(2), steady_focus
4:02.847 trickshots H wild_spirits Fluffy_Pillow 52.5/100: 53% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:04.036 trickshots I trueshot Fluffy_Pillow 60.1/100: 60% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:04.036 cds D blood_fury Fluffy_Pillow 60.1/100: 60% focus lock_and_load, precise_shots, steady_focus, trick_shots, trueshot
4:04.036 trickshots J aimed_shot Fluffy_Pillow 60.1/100: 60% focus blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot
4:05.224 trickshots L multishot Fluffy_Pillow 71.3/100: 71% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:06.412 trickshots J aimed_shot Fluffy_Pillow 62.6/100: 63% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:07.600 trickshots L multishot Fluffy_Pillow 38.9/100: 39% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:08.787 trickshots K rapid_fire Fluffy_Pillow 30.2/100: 30% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:10.696 trickshots L multishot Fluffy_Pillow 59.3/100: 59% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:11.885 trickshots J aimed_shot Fluffy_Pillow 50.4/100: 50% focus blood_fury, trick_shots, trueshot, wild_spirits
4:13.156 trickshots L multishot Fluffy_Pillow 26.6/100: 27% focus blood_fury, precise_shots(2), trueshot, wild_spirits
4:14.428 trickshots K rapid_fire Fluffy_Pillow 17.9/100: 18% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits
4:16.544 trickshots L multishot Fluffy_Pillow 47.7/100: 48% focus blood_fury, precise_shots, trueshot, wild_spirits
4:17.817 trickshots J aimed_shot Fluffy_Pillow 39.0/100: 39% focus blood_fury, trick_shots, trueshot, wild_spirits
4:19.089 trickshots O steady_shot Fluffy_Pillow 15.3/100: 15% focus precise_shots(2), trueshot, wild_spirits
4:20.573 trickshots F steady_shot Fluffy_Pillow 43.4/100: 43% focus precise_shots(2), trueshot, wild_spirits
4:22.057 trickshots L multishot Fluffy_Pillow 71.6/100: 72% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:23.247 trickshots J aimed_shot Fluffy_Pillow 62.9/100: 63% focus precise_shots, steady_focus, trick_shots, trueshot
4:24.435 trickshots L multishot Fluffy_Pillow 36.8/100: 37% focus precise_shots(2), steady_focus
4:25.623 trickshots K rapid_fire Fluffy_Pillow 24.3/100: 24% focus precise_shots, steady_focus, trick_shots
4:27.475 trickshots L multishot Fluffy_Pillow 43.1/100: 43% focus precise_shots, steady_focus
4:28.664 trickshots O steady_shot Fluffy_Pillow 30.6/100: 31% focus steady_focus, trick_shots
4:30.049 trickshots J aimed_shot Fluffy_Pillow 49.3/100: 49% focus steady_focus, trick_shots
4:32.028 default 9 use_items Fluffy_Pillow 26.9/100: 27% focus lock_and_load, precise_shots, steady_focus
4:32.028 trickshots L multishot Fluffy_Pillow 26.9/100: 27% focus lock_and_load, precise_shots, steady_focus
4:33.217 trickshots J aimed_shot Fluffy_Pillow 14.4/100: 14% focus lock_and_load, steady_focus, trick_shots
4:34.406 trickshots L multishot Fluffy_Pillow 21.9/100: 22% focus precise_shots, steady_focus
4:35.593 trickshots O steady_shot Fluffy_Pillow 9.4/100: 9% focus steady_focus, trick_shots
4:36.979 trickshots F steady_shot Fluffy_Pillow 28.2/100: 28% focus steady_focus, trick_shots
4:38.365 trickshots J aimed_shot Fluffy_Pillow 46.4/100: 46% focus lock_and_load, steady_focus, trick_shots
4:39.553 trickshots L multishot Fluffy_Pillow 54.0/100: 54% focus precise_shots, steady_focus
4:40.741 trickshots M kill_shot Fluffy_Pillow 41.5/100: 41% focus steady_focus, trick_shots
4:41.930 trickshots J aimed_shot Fluffy_Pillow 39.0/100: 39% focus steady_focus, trick_shots
4:43.907 trickshots O steady_shot Fluffy_Pillow 16.5/100: 17% focus precise_shots(2), steady_focus
4:45.295 trickshots L multishot Fluffy_Pillow 35.3/100: 35% focus precise_shots(2), steady_focus
4:46.484 trickshots K rapid_fire Fluffy_Pillow 22.8/100: 23% focus precise_shots, steady_focus, trick_shots
4:48.325 trickshots L multishot Fluffy_Pillow 41.5/100: 41% focus lock_and_load, precise_shots, steady_focus
4:49.514 trickshots J aimed_shot Fluffy_Pillow 29.0/100: 29% focus lock_and_load, steady_focus, trick_shots
4:50.705 trickshots L multishot Fluffy_Pillow 36.5/100: 37% focus precise_shots, steady_focus
4:51.894 trickshots M kill_shot Fluffy_Pillow 24.1/100: 24% focus steady_focus, trick_shots
4:53.083 trickshots G double_tap Fluffy_Pillow 21.6/100: 22% focus steady_focus, trick_shots
4:54.273 trickshots O steady_shot Fluffy_Pillow 28.7/100: 29% focus double_tap, trick_shots
4:55.756 trickshots F steady_shot Fluffy_Pillow 47.5/100: 48% focus double_tap, trick_shots
4:57.242 trickshots J aimed_shot Fluffy_Pillow 66.3/100: 66% focus double_tap, steady_focus, trick_shots
4:59.220 trickshots L multishot Fluffy_Pillow 43.8/100: 44% focus precise_shots(2), steady_focus
5:00.409 trickshots O steady_shot Fluffy_Pillow 31.4/100: 31% focus precise_shots, steady_focus, trick_shots
5:01.796 trickshots M kill_shot Fluffy_Pillow 50.1/100: 50% focus precise_shots, steady_focus, trick_shots
5:03.083 trickshots O steady_shot Fluffy_Pillow 48.3/100: 48% focus precise_shots, steady_focus, trick_shots
5:04.470 trickshots L multishot Fluffy_Pillow 67.1/100: 67% focus precise_shots, steady_focus, trick_shots
5:05.659 trickshots J aimed_shot Fluffy_Pillow 54.6/100: 55% focus steady_focus, trick_shots
5:07.638 trickshots L multishot Fluffy_Pillow 32.1/100: 32% focus precise_shots, steady_focus
5:08.827 trickshots K rapid_fire Fluffy_Pillow 19.6/100: 20% focus steady_focus, trick_shots
5:10.719 trickshots L multishot Fluffy_Pillow 38.6/100: 39% focus steady_focus
5:11.907 trickshots M kill_shot Fluffy_Pillow 26.1/100: 26% focus steady_focus, trick_shots
5:13.095 cds E potion Fluffy_Pillow 23.3/100: 23% focus trick_shots
5:13.095 trickshots O steady_shot Fluffy_Pillow 23.3/100: 23% focus trick_shots, potion_of_spectral_agility
5:14.579 trickshots F steady_shot Fluffy_Pillow 42.1/100: 42% focus lock_and_load, trick_shots, potion_of_spectral_agility
5:16.063 trickshots J aimed_shot Fluffy_Pillow 60.9/100: 61% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:17.251 trickshots L multishot Fluffy_Pillow 68.4/100: 68% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:18.438 trickshots J aimed_shot Fluffy_Pillow 55.9/100: 56% focus lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:19.625 trickshots L multishot Fluffy_Pillow 63.4/100: 63% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:20.814 trickshots O steady_shot Fluffy_Pillow 50.9/100: 51% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:22.200 trickshots L multishot Fluffy_Pillow 69.7/100: 70% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:23.388 trickshots J aimed_shot Fluffy_Pillow 57.2/100: 57% focus steady_focus, trick_shots, potion_of_spectral_agility
5:25.366 trickshots L multishot Fluffy_Pillow 34.7/100: 35% focus precise_shots, steady_focus, potion_of_spectral_agility
5:26.556 trickshots M kill_shot Fluffy_Pillow 22.3/100: 22% focus steady_focus, trick_shots, potion_of_spectral_agility
5:27.746 trickshots O steady_shot Fluffy_Pillow 19.8/100: 20% focus steady_focus, trick_shots, potion_of_spectral_agility
5:29.134 trickshots F steady_shot Fluffy_Pillow 38.6/100: 39% focus steady_focus, trick_shots, potion_of_spectral_agility
5:30.523 trickshots J aimed_shot Fluffy_Pillow 57.4/100: 57% focus steady_focus, trick_shots, potion_of_spectral_agility
5:32.501 trickshots L multishot Fluffy_Pillow 34.9/100: 35% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:33.691 trickshots K rapid_fire Fluffy_Pillow 22.4/100: 22% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:35.468 trickshots L multishot Fluffy_Pillow 40.7/100: 41% focus precise_shots, steady_focus, potion_of_spectral_agility
5:36.657 trickshots M kill_shot Fluffy_Pillow 28.2/100: 28% focus steady_focus, trick_shots, potion_of_spectral_agility
5:37.846 trickshots O steady_shot Fluffy_Pillow 25.7/100: 26% focus steady_focus, trick_shots, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 813 813 813
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 102 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="no_lego"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=813

secrets_ot_unblinking_vigil : 7856 dps, 3930 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
7855.8 7855.8 13.0 / 0.166% 948.3 / 12.1% 826.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.5 9.3 Focus 0.00% 46.4 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
secrets_ot_unblinking_vigil 7856
Aimed Shot 3058 (3317) 38.9% (42.2%) 59.9 4.98sec 16639 10341 Direct 179.4 (194.1) 4183 8347 5123 22.5% (22.5%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.88 179.40 0.00 0.00 1.6091 0.0000 918940.38 1312614.44 29.99% 10340.64 10340.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.45% 138.95 99 188 4183.32 2524 9967 4185.36 3867 4504 581300 830328 29.99%
crit 22.55% 40.45 19 67 8347.41 5048 19934 8352.25 6697 10678 337641 482286 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:60.14
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 259 3.3% 0.0 0.00sec 0 0 Direct 14.7 4300 8617 5264 22.4%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 14.68 0.00 0.00 0.0000 0.0000 77349.67 110486.27 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.59% 11.39 4 18 4299.52 2524 9967 4320.73 3217 5822 48978 69960 29.99%
crit 22.41% 3.29 0 9 8617.15 5048 19934 8441.81 0 19934 28372 40526 29.15%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 373 4.8% 113.2 2.66sec 991 433 Direct 112.9 809 1618 993 22.7%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.16 112.90 0.00 0.00 2.2863 0.0000 112097.49 160120.06 29.99% 433.29 433.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.29% 87.26 60 117 809.27 774 1019 809.21 793 823 70619 100873 29.99%
crit 22.71% 25.64 11 42 1617.63 1548 2037 1617.75 1556 1696 41478 59247 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 137 1.7% 3.8 90.79sec 10995 0 Direct 3.7 9034 18051 11033 22.2%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.75 3.74 0.00 0.00 0.0000 0.0000 41255.31 41255.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.80% 2.91 0 4 9033.74 8937 9474 8978.26 0 9474 26275 26275 0.00%
crit 22.20% 0.83 0 4 18051.30 17875 18947 11034.79 0 18947 14980 14980 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.5% 21.7 13.40sec 547 0 Direct 21.7 446 891 548 22.8%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.74 21.74 0.00 0.00 0.0000 0.0000 11898.59 11898.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.20% 16.78 4 30 445.87 435 485 445.85 435 456 7482 7482 0.00%
crit 22.80% 4.96 0 13 891.29 871 969 886.30 0 969 4417 4417 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 70 0.9% 3.9 15.79sec 5406 4469 Direct 3.9 4248 9579 5447 22.6%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.89 3.86 0.00 0.00 1.2098 0.0000 21035.18 30046.65 29.99% 4468.91 4468.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.43% 2.99 0 7 4247.88 4065 4838 4202.22 0 4838 12693 18131 29.72%
crit 22.57% 0.87 0 4 9578.64 9146 10885 5941.19 0 10885 8342 11915 18.59%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:3.89
  • if_expr:buff.dead_eye.down
Master Marksman 355 4.5% 188.3 1.58sec 567 0 Periodic 321.7 332 0 332 0.0% 71.3%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 188.33 0.00 321.73 321.73 0.0000 2.0000 106753.76 106753.76 0.00% 165.91 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 321.73 224 427 331.74 37 2621 332.07 249 424 106754 106754 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 1735 22.1% 82.5 3.63sec 6323 5528 Direct 247.0 1721 3441 2113 22.8%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.53 247.02 0.00 0.00 1.1439 0.0000 521825.04 745374.89 29.99% 5527.81 5527.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.22% 190.74 136 246 1720.56 953 2194 1720.64 1646 1767 328200 468802 29.99%
crit 22.78% 56.28 33 87 3440.80 1905 4389 3440.56 3206 3632 193625 276573 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:82.07
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:0.46
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 676 8.6% 15.3 19.68sec 13281 7552 Periodic 333.6 496 994 609 22.7% 2.6%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.31 0.00 111.50 333.63 1.7588 0.2071 203354.55 290471.64 29.99% 7551.51 7551.51
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.27% 257.81 170 372 496.32 351 925 496.28 476 518 127955 182770 29.99%
crit 22.73% 75.83 39 117 994.30 703 1850 994.54 858 1162 75400 107701 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:15.32
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.6% 43.5 6.84sec 302 0 Direct 43.5 245 491 302 23.0%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.49 43.49 0.00 0.00 0.0000 0.0000 13124.29 13124.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.98% 33.48 14 53 245.30 239 266 245.32 241 250 8212 8212 0.00%
crit 23.02% 10.01 2 21 490.70 479 533 490.63 479 513 4912 4912 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 265 3.4% 50.8 5.88sec 1571 1150 Direct 51.7 1260 2519 1543 22.5%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.82 51.72 0.00 0.00 1.3662 0.0000 79832.16 114032.26 29.99% 1149.86 1149.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.49% 40.08 22 61 1259.92 1219 1605 1259.36 1227 1296 50503 72139 29.99%
crit 22.51% 11.64 3 25 2518.90 2439 3210 2518.48 2439 2727 29329 41893 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.48
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:34.53
Wild Spirits 30 (844) 0.4% (10.7%) 3.0 120.66sec 84712 76638 Direct 8.9 (140.4) 810 1620 994 22.7% (22.6%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 8.90 0.00 0.00 1.1055 0.0000 8845.89 8845.89 0.00% 76637.97 76637.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.30% 6.88 1 9 809.66 776 910 809.79 776 858 5572 5572 0.00%
crit 22.70% 2.02 0 7 1619.96 1552 1820 1448.80 0 1820 3274 3274 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 814 10.3% 43.8 5.85sec 5553 0 Direct 131.5 1510 3017 1851 22.6%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.82 131.47 0.00 0.00 0.0000 0.0000 243369.66 243369.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.37% 101.73 67 121 1509.96 1355 1699 1510.64 1479 1561 153607 153607 0.00%
crit 22.63% 29.75 11 48 3017.48 2711 3398 3018.74 2921 3168 89762 89762 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
secrets_ot_unblinking_vigil
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:secrets_ot_unblinking_vigil
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.80sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.65sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 0.00 0.00 0.00 0.9814 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.63
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:secrets_ot_unblinking_vigil
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:secrets_ot_unblinking_vigil
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 308.94sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.48
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.80sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.63% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • blood_fury_1:14.63%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.5sec 60.6sec 4.0sec 7.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s

Stack Uptimes

  • double_tap_1:7.56%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.7 0.2 30.7sec 29.8sec 1.8sec 5.18% 14.33% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 262.4s
  • trigger_min/max:1.8s / 262.4s
  • trigger_pct:7.94%
  • duration_min/max:0.0s / 10.5s

Stack Uptimes

  • lock_and_load_1:5.18%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.1sec 309.1sec 23.1sec 11.17% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.2s
  • trigger_min/max:300.0s / 332.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.17%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 38.1 21.7 7.8sec 5.0sec 4.2sec 53.78% 94.84% 11.0 (11.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 46.6s
  • trigger_min/max:0.9s / 14.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.9s

Stack Uptimes

  • precise_shots_1:46.14%
  • precise_shots_2:7.63%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Secrets of the Unblinking Vigil 32.6 8.7 9.2sec 7.2sec 2.0sec 22.02% 32.91% 8.7 (8.7) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_secrets_of_the_unblinking_vigil
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:50.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 71.6s
  • trigger_min/max:0.9s / 69.2s
  • trigger_pct:50.01%
  • duration_min/max:0.0s / 8.1s

Stack Uptimes

  • secrets_of_the_unblinking_vigil_1:22.02%

Spelldata

  • id:336892
  • name:Secrets of the Unblinking Vigil
  • tooltip:Your next Aimed Shot will consume {$s1=100}% less Focus.
  • description:{$@spelldesc336878=When you gain the Trick Shots effect, you have a {$h=50}% chance to refund a charge of Aimed Shot, and cause your next Aimed Shot to not consume any Focus.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:336878
  • name:Secrets of the Unblinking Vigil
  • tooltip:
  • description:When you gain the Trick Shots effect, you have a {$h=50}% chance to refund a charge of Aimed Shot, and cause your next Aimed Shot to not consume any Focus.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:50.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 9.1 11.1 34.5sec 15.1sec 27.9sec 84.63% 0.00% 11.1 (11.1) 8.3

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 191.0s
  • trigger_min/max:4.0s / 59.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 178.9s

Stack Uptimes

  • steady_focus_1:84.63%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 76.0 6.5 3.9sec 3.6sec 3.4sec 86.99% 100.00% 6.5 (6.5) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 11.1s
  • trigger_min/max:0.9s / 10.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.1s

Stack Uptimes

  • trick_shots_1:86.99%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.2sec 19.01% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • trueshot_1:19.01%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.6sec 17.45% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.45%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.9 2.0 7.0 65.5s 47.1s 249.5s
double_tap_rapid_fire 0.6 0.0 4.0 118.7s 57.3s 244.9s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.88% 0.68% 2.00% 0.8s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7640.0012.6983.0170.1388.398
Aimed Shot1.6220.00110.78763.21426.375106.706
Kill Shot5.7480.00142.08815.8680.00042.088
Wild Spirits0.8060.0012.7071.3530.0004.623
Trueshot0.8730.0012.9551.6360.2724.896
Rapid Fire4.2850.00138.40258.52724.886102.360

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
secrets_ot_unblinking_vigil
steady_shot Focus 51.80 498.01 17.87% 9.61 20.01 3.86%
rapid_fire Focus 111.55 111.39 4.00% 1.00 0.16 0.14%
focus_regen Focus 595.97 1938.51 69.54% 3.25 19.31 0.99%
Trueshot Focus 186.98 239.59 8.60% 1.28 1.10 0.46%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.26 9.48 40.6 34.0 0.0 96.4
Usage Type Count Total Avg RPE APR
secrets_ot_unblinking_vigil
aimed_shot Focus 59.9 1164.0 19.4 19.4 855.9
kill_shot Focus 3.9 38.9 10.0 10.0 541.0
multishot Focus 82.5 1650.6 20.0 20.0 316.1

Statistics & Data Analysis

Fight Length
secrets_ot_unblinking_vigil Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
secrets_ot_unblinking_vigil Damage Per Second
Count 1323
Mean 7855.81
Minimum 6982.40
Maximum 8739.90
Spread ( max - min ) 1757.51
Range [ ( max - min ) / 2 * 100% ] 11.19%
Standard Deviation 242.0855
5th Percentile 7476.39
95th Percentile 8261.11
( 95th Percentile - 5th Percentile ) 784.73
Mean Distribution
Standard Deviation 6.6556
95.00% Confidence Interval ( 7842.76 - 7868.85 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3648
0.1 Scale Factor Error with Delta=300 501
0.05 Scale Factor Error with Delta=300 2002
0.01 Scale Factor Error with Delta=300 50029
Priority Target DPS
secrets_ot_unblinking_vigil Priority Target Damage Per Second
Count 1323
Mean 3929.58
Minimum 3480.90
Maximum 4394.50
Spread ( max - min ) 913.60
Range [ ( max - min ) / 2 * 100% ] 11.62%
Standard Deviation 135.6828
5th Percentile 3718.30
95th Percentile 4165.47
( 95th Percentile - 5th Percentile ) 447.17
Mean Distribution
Standard Deviation 3.7303
95.00% Confidence Interval ( 3922.27 - 3936.89 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4580
0.1 Scale Factor Error with Delta=300 158
0.05 Scale Factor Error with Delta=300 629
0.01 Scale Factor Error with Delta=300 15716
DPS(e)
secrets_ot_unblinking_vigil Damage Per Second (Effective)
Count 1323
Mean 7855.81
Minimum 6982.40
Maximum 8739.90
Spread ( max - min ) 1757.51
Range [ ( max - min ) / 2 * 100% ] 11.19%
Damage
secrets_ot_unblinking_vigil Damage
Count 1323
Mean 2359682.00
Minimum 1772328.14
Maximum 2890076.43
Spread ( max - min ) 1117748.29
Range [ ( max - min ) / 2 * 100% ] 23.68%
DTPS
secrets_ot_unblinking_vigil Damage Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
secrets_ot_unblinking_vigil Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
secrets_ot_unblinking_vigil Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
secrets_ot_unblinking_vigil Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
secrets_ot_unblinking_vigil Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
secrets_ot_unblinking_vigil Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
secrets_ot_unblinking_vigilTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
secrets_ot_unblinking_vigil Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.76 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.48 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.48 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.63 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 60.14 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 15.32 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 82.07 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 3.89 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 0.46 multishot,if=focus>cost+action.aimed_shot.cost
O 34.53 steady_shot

Sample Sequence

0125789FHIDELJLJLKLJLJLKLJOFLJLKLJOLOOLJLOOJLOOKLJLJLOOGLJLOJOFLJLKLJLLJLJLJLOFJLK9LOJLOFJLJLJLOOKGLJLLJLHIDJLKLJLKLJOFLJLJLKLOFJLJLLJLOFJLJLKLGOFJLJL9OOLJLOKLJLOFLJLLJLONOFJLJLJLKLJLOFJLGOOLJLKHIDLJLOFJLJLKLJOFLJLKLOJ9LMOFJLOOJLKLMOOGJLOJLMOFKLJLJELMOFJLOOLJLJLKLMOFJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask secrets_ot_unblinking_vigil 100.0/100: 100% focus
Pre precombat 1 augmentation secrets_ot_unblinking_vigil 100.0/100: 100% focus
Pre precombat 2 food secrets_ot_unblinking_vigil 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.484 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.401 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.401 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.317 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.232 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.147 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.062 trickshots L multishot Fluffy_Pillow 34.5/100: 35% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.976 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:08.386 trickshots L multishot Fluffy_Pillow 55.2/100: 55% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:09.302 trickshots J aimed_shot Fluffy_Pillow 46.5/100: 46% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, secrets_of_the_unblinking_vigil, potion_of_spectral_agility
0:10.216 trickshots L multishot Fluffy_Pillow 57.8/100: 58% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, secrets_of_the_unblinking_vigil, potion_of_spectral_agility
0:11.131 trickshots J aimed_shot Fluffy_Pillow 49.1/100: 49% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.047 trickshots L multishot Fluffy_Pillow 25.4/100: 25% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:12.962 trickshots K rapid_fire Fluffy_Pillow 16.7/100: 17% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.431 trickshots L multishot Fluffy_Pillow 43.8/100: 44% focus bloodlust, blood_fury, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:15.346 trickshots J aimed_shot Fluffy_Pillow 35.1/100: 35% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:16.264 trickshots O steady_shot Fluffy_Pillow 11.4/100: 11% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:17.334 trickshots F steady_shot Fluffy_Pillow 38.9/100: 39% focus bloodlust, blood_fury, precise_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:18.476 trickshots L multishot Fluffy_Pillow 67.1/100: 67% focus bloodlust, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:19.392 trickshots J aimed_shot Fluffy_Pillow 58.4/100: 58% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:20.308 trickshots L multishot Fluffy_Pillow 34.7/100: 35% focus bloodlust, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:21.224 trickshots K rapid_fire Fluffy_Pillow 26.0/100: 26% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:22.741 trickshots L multishot Fluffy_Pillow 51.9/100: 52% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:23.655 trickshots J aimed_shot Fluffy_Pillow 39.4/100: 39% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:25.178 trickshots O steady_shot Fluffy_Pillow 17.0/100: 17% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:26.244 trickshots L multishot Fluffy_Pillow 35.7/100: 36% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:27.161 trickshots O steady_shot Fluffy_Pillow 23.3/100: 23% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:28.229 trickshots O steady_shot Fluffy_Pillow 42.1/100: 42% focus bloodlust, precise_shots, steady_focus, trick_shots
0:29.297 trickshots L multishot Fluffy_Pillow 60.9/100: 61% focus bloodlust, precise_shots, steady_focus, trick_shots
0:30.212 trickshots J aimed_shot Fluffy_Pillow 48.4/100: 48% focus bloodlust, steady_focus, trick_shots
0:31.735 trickshots L multishot Fluffy_Pillow 25.9/100: 26% focus bloodlust, precise_shots, steady_focus
0:32.651 trickshots O steady_shot Fluffy_Pillow 13.5/100: 13% focus bloodlust, steady_focus, trick_shots
0:33.719 trickshots O steady_shot Fluffy_Pillow 32.2/100: 32% focus bloodlust, steady_focus, trick_shots
0:34.785 trickshots J aimed_shot Fluffy_Pillow 51.0/100: 51% focus bloodlust, steady_focus, trick_shots
0:36.309 trickshots L multishot Fluffy_Pillow 28.6/100: 29% focus bloodlust, precise_shots(2), steady_focus
0:37.223 trickshots O steady_shot Fluffy_Pillow 16.1/100: 16% focus bloodlust, precise_shots, steady_focus, trick_shots
0:38.290 trickshots O steady_shot Fluffy_Pillow 34.9/100: 35% focus bloodlust, precise_shots, steady_focus, trick_shots
0:39.358 trickshots K rapid_fire Fluffy_Pillow 53.6/100: 54% focus bloodlust, precise_shots, steady_focus, trick_shots
0:40.643 trickshots L multishot Fluffy_Pillow 71.2/100: 71% focus bloodlust, precise_shots, steady_focus
0:41.559 trickshots J aimed_shot Fluffy_Pillow 57.7/100: 58% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
0:43.537 trickshots L multishot Fluffy_Pillow 70.2/100: 70% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
0:44.727 trickshots J aimed_shot Fluffy_Pillow 57.7/100: 58% focus precise_shots, steady_focus, trick_shots
0:46.706 trickshots L multishot Fluffy_Pillow 35.3/100: 35% focus precise_shots(2), steady_focus
0:47.895 trickshots O steady_shot Fluffy_Pillow 22.8/100: 23% focus precise_shots, steady_focus, trick_shots
0:49.282 trickshots O steady_shot Fluffy_Pillow 41.6/100: 42% focus precise_shots, steady_focus, trick_shots
0:50.667 trickshots G double_tap Fluffy_Pillow 60.3/100: 60% focus precise_shots, steady_focus, trick_shots
0:51.855 trickshots L multishot Fluffy_Pillow 67.9/100: 68% focus double_tap, precise_shots, steady_focus, trick_shots
0:53.043 trickshots J aimed_shot Fluffy_Pillow 55.4/100: 55% focus double_tap, steady_focus, trick_shots
0:55.021 trickshots L multishot Fluffy_Pillow 32.9/100: 33% focus precise_shots, steady_focus
0:56.211 trickshots O steady_shot Fluffy_Pillow 20.4/100: 20% focus steady_focus, trick_shots
0:57.597 trickshots J aimed_shot Fluffy_Pillow 39.2/100: 39% focus steady_focus, trick_shots
0:59.575 trickshots O steady_shot Fluffy_Pillow 16.7/100: 17% focus precise_shots(2), steady_focus
1:00.960 trickshots F steady_shot Fluffy_Pillow 35.5/100: 35% focus precise_shots(2), steady_focus
1:02.346 trickshots L multishot Fluffy_Pillow 54.3/100: 54% focus precise_shots(2), steady_focus
1:03.537 trickshots J aimed_shot Fluffy_Pillow 41.8/100: 42% focus precise_shots, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
1:05.516 trickshots L multishot Fluffy_Pillow 54.3/100: 54% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
1:06.703 trickshots K rapid_fire Fluffy_Pillow 41.8/100: 42% focus precise_shots, steady_focus, trick_shots
1:08.557 trickshots L multishot Fluffy_Pillow 60.6/100: 61% focus precise_shots, steady_focus
1:09.749 trickshots J aimed_shot Fluffy_Pillow 48.1/100: 48% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
1:11.728 trickshots L multishot Fluffy_Pillow 60.6/100: 61% focus lock_and_load, precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
1:12.916 trickshots L multishot Fluffy_Pillow 48.2/100: 48% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:14.106 trickshots J aimed_shot Fluffy_Pillow 35.7/100: 36% focus lock_and_load, steady_focus, trick_shots
1:15.293 trickshots L multishot Fluffy_Pillow 43.2/100: 43% focus precise_shots, steady_focus
1:16.481 trickshots J aimed_shot Fluffy_Pillow 30.7/100: 31% focus lock_and_load, steady_focus, trick_shots
1:17.670 trickshots L multishot Fluffy_Pillow 38.1/100: 38% focus precise_shots(2)
1:18.941 trickshots J aimed_shot Fluffy_Pillow 25.6/100: 26% focus precise_shots, trick_shots, secrets_of_the_unblinking_vigil
1:21.059 trickshots L multishot Fluffy_Pillow 38.2/100: 38% focus precise_shots(2), secrets_of_the_unblinking_vigil
1:22.330 trickshots O steady_shot Fluffy_Pillow 25.7/100: 26% focus precise_shots, trick_shots
1:23.813 trickshots F steady_shot Fluffy_Pillow 44.4/100: 44% focus precise_shots, trick_shots
1:25.296 trickshots J aimed_shot Fluffy_Pillow 63.2/100: 63% focus precise_shots, steady_focus, trick_shots
1:27.273 trickshots L multishot Fluffy_Pillow 40.7/100: 41% focus precise_shots(2), steady_focus
1:28.462 trickshots K rapid_fire Fluffy_Pillow 28.3/100: 28% focus precise_shots, steady_focus, trick_shots
1:30.312 default 9 use_items Fluffy_Pillow 47.0/100: 47% focus precise_shots, steady_focus
1:30.312 trickshots L multishot Fluffy_Pillow 47.0/100: 47% focus precise_shots, steady_focus
1:31.500 trickshots O steady_shot Fluffy_Pillow 34.5/100: 34% focus steady_focus, trick_shots
1:32.886 trickshots J aimed_shot Fluffy_Pillow 53.3/100: 53% focus steady_focus, trick_shots
1:34.863 trickshots L multishot Fluffy_Pillow 30.8/100: 31% focus precise_shots, steady_focus
1:36.053 trickshots O steady_shot Fluffy_Pillow 18.3/100: 18% focus steady_focus, trick_shots
1:37.438 trickshots F steady_shot Fluffy_Pillow 37.1/100: 37% focus steady_focus, trick_shots
1:38.824 trickshots J aimed_shot Fluffy_Pillow 55.8/100: 56% focus steady_focus, trick_shots
1:40.802 trickshots L multishot Fluffy_Pillow 33.4/100: 33% focus lock_and_load, precise_shots, steady_focus
1:41.992 trickshots J aimed_shot Fluffy_Pillow 20.9/100: 21% focus lock_and_load, steady_focus, trick_shots
1:43.182 trickshots L multishot Fluffy_Pillow 28.4/100: 28% focus lock_and_load, precise_shots, steady_focus
1:44.371 trickshots J aimed_shot Fluffy_Pillow 15.9/100: 16% focus lock_and_load, steady_focus, trick_shots
1:45.559 trickshots L multishot Fluffy_Pillow 23.5/100: 23% focus precise_shots(2), steady_focus
1:46.749 trickshots O steady_shot Fluffy_Pillow 11.0/100: 11% focus precise_shots, steady_focus, trick_shots
1:48.136 trickshots O steady_shot Fluffy_Pillow 29.8/100: 30% focus precise_shots, steady_focus, trick_shots
1:49.524 trickshots K rapid_fire Fluffy_Pillow 48.6/100: 49% focus precise_shots, steady_focus, trick_shots
1:51.415 trickshots G double_tap Fluffy_Pillow 67.5/100: 68% focus precise_shots, steady_focus
1:52.603 trickshots L multishot Fluffy_Pillow 75.0/100: 75% focus double_tap, precise_shots, steady_focus
1:53.791 trickshots J aimed_shot Fluffy_Pillow 62.6/100: 63% focus double_tap, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
1:55.769 trickshots L multishot Fluffy_Pillow 75.1/100: 75% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
1:56.958 trickshots L multishot Fluffy_Pillow 62.6/100: 63% focus precise_shots, steady_focus, trick_shots
1:58.148 trickshots J aimed_shot Fluffy_Pillow 50.1/100: 50% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
2:00.127 trickshots L multishot Fluffy_Pillow 62.7/100: 63% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
2:01.316 trickshots H wild_spirits Fluffy_Pillow 50.2/100: 50% focus precise_shots, steady_focus, trick_shots
2:02.672 trickshots I trueshot Fluffy_Pillow 58.8/100: 59% focus precise_shots, steady_focus, trick_shots
2:02.672 cds D blood_fury Fluffy_Pillow 58.8/100: 59% focus precise_shots, steady_focus, trick_shots, trueshot
2:02.672 trickshots J aimed_shot Fluffy_Pillow 58.8/100: 59% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:03.862 trickshots L multishot Fluffy_Pillow 35.1/100: 35% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:05.050 trickshots K rapid_fire Fluffy_Pillow 26.0/100: 26% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits
2:06.961 trickshots L multishot Fluffy_Pillow 54.0/100: 54% focus blood_fury, precise_shots, trueshot, wild_spirits
2:08.234 trickshots J aimed_shot Fluffy_Pillow 45.3/100: 45% focus blood_fury, trick_shots, trueshot, wild_spirits
2:09.506 trickshots L multishot Fluffy_Pillow 21.6/100: 22% focus blood_fury, precise_shots, trueshot, wild_spirits
2:10.778 trickshots K rapid_fire Fluffy_Pillow 12.8/100: 13% focus blood_fury, trick_shots, trueshot, wild_spirits
2:12.864 trickshots L multishot Fluffy_Pillow 44.4/100: 44% focus blood_fury, trueshot, wild_spirits
2:14.137 trickshots J aimed_shot Fluffy_Pillow 35.7/100: 36% focus blood_fury, trick_shots, trueshot, wild_spirits
2:15.409 trickshots O steady_shot Fluffy_Pillow 11.9/100: 12% focus blood_fury, precise_shots(2), trueshot, wild_spirits
2:16.893 trickshots F steady_shot Fluffy_Pillow 40.1/100: 40% focus blood_fury, precise_shots(2), trueshot, wild_spirits
2:18.378 trickshots L multishot Fluffy_Pillow 68.3/100: 68% focus precise_shots(2), steady_focus, trueshot, wild_spirits
2:19.567 trickshots J aimed_shot Fluffy_Pillow 59.6/100: 60% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, secrets_of_the_unblinking_vigil
2:20.756 trickshots L multishot Fluffy_Pillow 70.9/100: 71% focus precise_shots(2), steady_focus, trueshot, wild_spirits, secrets_of_the_unblinking_vigil
2:21.943 trickshots J aimed_shot Fluffy_Pillow 62.1/100: 62% focus precise_shots, steady_focus, trick_shots, trueshot
2:23.132 trickshots L multishot Fluffy_Pillow 35.9/100: 36% focus precise_shots(2), steady_focus
2:24.320 trickshots K rapid_fire Fluffy_Pillow 23.4/100: 23% focus precise_shots, steady_focus, trick_shots
2:26.158 trickshots L multishot Fluffy_Pillow 42.0/100: 42% focus precise_shots, steady_focus
2:27.346 trickshots O steady_shot Fluffy_Pillow 29.5/100: 30% focus steady_focus, trick_shots
2:28.733 trickshots F steady_shot Fluffy_Pillow 48.3/100: 48% focus steady_focus, trick_shots
2:30.118 trickshots J aimed_shot Fluffy_Pillow 67.1/100: 67% focus lock_and_load, steady_focus, trick_shots
2:31.305 trickshots L multishot Fluffy_Pillow 74.6/100: 75% focus precise_shots(2), steady_focus
2:32.494 trickshots J aimed_shot Fluffy_Pillow 62.1/100: 62% focus precise_shots, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
2:34.471 trickshots L multishot Fluffy_Pillow 74.6/100: 75% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
2:35.659 trickshots L multishot Fluffy_Pillow 62.1/100: 62% focus precise_shots, steady_focus, trick_shots
2:36.849 trickshots J aimed_shot Fluffy_Pillow 49.7/100: 50% focus steady_focus, trick_shots
2:38.827 trickshots L multishot Fluffy_Pillow 27.2/100: 27% focus precise_shots, steady_focus
2:40.015 trickshots O steady_shot Fluffy_Pillow 14.7/100: 15% focus steady_focus, trick_shots
2:41.401 trickshots F steady_shot Fluffy_Pillow 33.5/100: 33% focus steady_focus, trick_shots
2:42.787 trickshots J aimed_shot Fluffy_Pillow 52.3/100: 52% focus steady_focus, trick_shots
2:44.766 trickshots L multishot Fluffy_Pillow 29.8/100: 30% focus lock_and_load, precise_shots, steady_focus
2:45.954 trickshots J aimed_shot Fluffy_Pillow 17.3/100: 17% focus lock_and_load, steady_focus, trick_shots
2:47.143 trickshots L multishot Fluffy_Pillow 24.8/100: 25% focus precise_shots(2), steady_focus
2:48.333 trickshots K rapid_fire Fluffy_Pillow 12.4/100: 12% focus precise_shots, steady_focus, trick_shots
2:50.165 trickshots L multishot Fluffy_Pillow 31.0/100: 31% focus precise_shots, steady_focus
2:51.353 trickshots G double_tap Fluffy_Pillow 18.5/100: 18% focus steady_focus, trick_shots
2:52.603 trickshots O steady_shot Fluffy_Pillow 26.4/100: 26% focus double_tap, steady_focus, trick_shots
2:53.990 trickshots F steady_shot Fluffy_Pillow 45.2/100: 45% focus double_tap, steady_focus, trick_shots
2:55.377 trickshots J aimed_shot Fluffy_Pillow 63.9/100: 64% focus double_tap, lock_and_load, steady_focus, trick_shots
2:56.565 trickshots L multishot Fluffy_Pillow 71.5/100: 71% focus precise_shots, steady_focus
2:57.753 trickshots J aimed_shot Fluffy_Pillow 59.0/100: 59% focus steady_focus, trick_shots
2:59.731 trickshots L multishot Fluffy_Pillow 36.5/100: 36% focus precise_shots(2), steady_focus
3:00.919 default 9 use_items Fluffy_Pillow 24.0/100: 24% focus precise_shots, steady_focus, trick_shots
3:00.919 trickshots O steady_shot Fluffy_Pillow 24.0/100: 24% focus precise_shots, steady_focus, trick_shots
3:02.306 trickshots O steady_shot Fluffy_Pillow 42.8/100: 43% focus precise_shots, steady_focus, trick_shots
3:03.691 trickshots L multishot Fluffy_Pillow 61.6/100: 62% focus precise_shots, steady_focus, trick_shots
3:04.879 trickshots J aimed_shot Fluffy_Pillow 49.1/100: 49% focus steady_focus, trick_shots
3:06.857 trickshots L multishot Fluffy_Pillow 26.6/100: 27% focus precise_shots, steady_focus
3:08.044 trickshots O steady_shot Fluffy_Pillow 14.1/100: 14% focus steady_focus, trick_shots
3:09.431 trickshots K rapid_fire Fluffy_Pillow 32.9/100: 33% focus steady_focus, trick_shots
3:11.322 trickshots L multishot Fluffy_Pillow 51.9/100: 52% focus steady_focus
3:12.511 trickshots J aimed_shot Fluffy_Pillow 39.4/100: 39% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
3:14.491 trickshots L multishot Fluffy_Pillow 51.9/100: 52% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
3:15.679 trickshots O steady_shot Fluffy_Pillow 39.4/100: 39% focus precise_shots, steady_focus, trick_shots
3:17.066 trickshots F steady_shot Fluffy_Pillow 58.2/100: 58% focus precise_shots, steady_focus, trick_shots
3:18.451 trickshots L multishot Fluffy_Pillow 77.0/100: 77% focus precise_shots, steady_focus, trick_shots
3:19.639 trickshots J aimed_shot Fluffy_Pillow 64.5/100: 64% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
3:21.615 trickshots L multishot Fluffy_Pillow 77.0/100: 77% focus lock_and_load, precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
3:22.804 trickshots L multishot Fluffy_Pillow 64.5/100: 65% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:23.993 trickshots J aimed_shot Fluffy_Pillow 52.1/100: 52% focus lock_and_load, steady_focus, trick_shots
3:25.181 trickshots L multishot Fluffy_Pillow 59.6/100: 60% focus precise_shots, steady_focus
3:26.369 trickshots O steady_shot Fluffy_Pillow 47.1/100: 47% focus steady_focus, trick_shots
3:27.755 trickshots N multishot Fluffy_Pillow 65.9/100: 66% focus steady_focus, trick_shots
3:28.943 trickshots O steady_shot Fluffy_Pillow 53.4/100: 53% focus steady_focus, trick_shots
3:30.330 trickshots F steady_shot Fluffy_Pillow 72.2/100: 72% focus steady_focus, trick_shots
3:31.716 trickshots J aimed_shot Fluffy_Pillow 90.9/100: 91% focus steady_focus, trick_shots
3:33.694 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus lock_and_load, precise_shots, steady_focus
3:34.884 trickshots J aimed_shot Fluffy_Pillow 52.6/100: 53% focus lock_and_load, steady_focus, trick_shots
3:36.073 trickshots L multishot Fluffy_Pillow 60.1/100: 60% focus lock_and_load, precise_shots(2), steady_focus
3:37.260 trickshots J aimed_shot Fluffy_Pillow 47.6/100: 48% focus lock_and_load, precise_shots, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
3:38.450 trickshots L multishot Fluffy_Pillow 55.1/100: 55% focus precise_shots(2), steady_focus
3:39.639 trickshots K rapid_fire Fluffy_Pillow 42.7/100: 43% focus precise_shots, steady_focus, trick_shots
3:41.447 trickshots L multishot Fluffy_Pillow 61.1/100: 61% focus precise_shots, steady_focus
3:42.636 trickshots J aimed_shot Fluffy_Pillow 48.6/100: 49% focus steady_focus, trick_shots
3:44.615 trickshots L multishot Fluffy_Pillow 26.1/100: 26% focus precise_shots, steady_focus
3:45.803 trickshots O steady_shot Fluffy_Pillow 13.7/100: 14% focus steady_focus, trick_shots
3:47.190 trickshots F steady_shot Fluffy_Pillow 32.2/100: 32% focus trick_shots
3:48.673 trickshots J aimed_shot Fluffy_Pillow 51.0/100: 51% focus steady_focus, trick_shots
3:50.652 trickshots L multishot Fluffy_Pillow 28.5/100: 29% focus precise_shots(2), steady_focus
3:51.842 trickshots G double_tap Fluffy_Pillow 16.1/100: 16% focus precise_shots, steady_focus, trick_shots
3:53.030 trickshots O steady_shot Fluffy_Pillow 23.6/100: 24% focus double_tap, precise_shots, steady_focus, trick_shots
3:54.417 trickshots O steady_shot Fluffy_Pillow 42.4/100: 42% focus double_tap, precise_shots, steady_focus, trick_shots
3:55.804 trickshots L multishot Fluffy_Pillow 61.2/100: 61% focus double_tap, precise_shots, steady_focus, trick_shots
3:56.992 trickshots J aimed_shot Fluffy_Pillow 48.7/100: 49% focus double_tap, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
3:58.970 trickshots L multishot Fluffy_Pillow 61.2/100: 61% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
4:00.158 trickshots K rapid_fire Fluffy_Pillow 48.7/100: 49% focus precise_shots, steady_focus, trick_shots
4:02.000 trickshots H wild_spirits Fluffy_Pillow 67.4/100: 67% focus precise_shots, steady_focus
4:03.189 trickshots I trueshot Fluffy_Pillow 74.9/100: 75% focus precise_shots, steady_focus
4:03.189 cds D blood_fury Fluffy_Pillow 74.9/100: 75% focus precise_shots, steady_focus, trueshot
4:03.189 trickshots L multishot Fluffy_Pillow 74.9/100: 75% focus blood_fury, precise_shots, steady_focus, trueshot
4:04.378 trickshots J aimed_shot Fluffy_Pillow 66.2/100: 66% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:05.566 trickshots L multishot Fluffy_Pillow 42.5/100: 42% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:06.754 trickshots O steady_shot Fluffy_Pillow 33.7/100: 34% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:08.142 trickshots F steady_shot Fluffy_Pillow 61.9/100: 62% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:09.527 trickshots J aimed_shot Fluffy_Pillow 90.1/100: 90% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:10.715 trickshots L multishot Fluffy_Pillow 66.3/100: 66% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:11.900 trickshots J aimed_shot Fluffy_Pillow 57.6/100: 58% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:13.088 trickshots L multishot Fluffy_Pillow 33.9/100: 34% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:14.276 trickshots K rapid_fire Fluffy_Pillow 25.2/100: 25% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:16.034 trickshots L multishot Fluffy_Pillow 51.8/100: 52% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:17.222 trickshots J aimed_shot Fluffy_Pillow 43.1/100: 43% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:18.412 trickshots O steady_shot Fluffy_Pillow 19.4/100: 19% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:19.798 trickshots F steady_shot Fluffy_Pillow 47.6/100: 48% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:21.185 trickshots L multishot Fluffy_Pillow 75.7/100: 76% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:22.372 trickshots J aimed_shot Fluffy_Pillow 67.0/100: 67% focus precise_shots, steady_focus, trick_shots, trueshot
4:23.561 trickshots L multishot Fluffy_Pillow 41.0/100: 41% focus precise_shots(2), steady_focus
4:24.750 trickshots K rapid_fire Fluffy_Pillow 28.5/100: 29% focus precise_shots, steady_focus, trick_shots
4:26.529 trickshots L multishot Fluffy_Pillow 46.8/100: 47% focus precise_shots, steady_focus
4:27.717 trickshots O steady_shot Fluffy_Pillow 34.3/100: 34% focus steady_focus, trick_shots
4:29.104 trickshots J aimed_shot Fluffy_Pillow 53.1/100: 53% focus steady_focus, trick_shots
4:31.081 default 9 use_items Fluffy_Pillow 30.6/100: 31% focus precise_shots, steady_focus
4:31.081 trickshots L multishot Fluffy_Pillow 30.6/100: 31% focus precise_shots, steady_focus
4:32.269 trickshots M kill_shot Fluffy_Pillow 18.1/100: 18% focus steady_focus, trick_shots
4:33.459 trickshots O steady_shot Fluffy_Pillow 15.7/100: 16% focus steady_focus, trick_shots
4:34.846 trickshots F steady_shot Fluffy_Pillow 34.4/100: 34% focus steady_focus, trick_shots
4:36.234 trickshots J aimed_shot Fluffy_Pillow 53.2/100: 53% focus steady_focus, trick_shots
4:38.212 trickshots L multishot Fluffy_Pillow 30.7/100: 31% focus precise_shots, steady_focus
4:39.401 trickshots O steady_shot Fluffy_Pillow 18.3/100: 18% focus steady_focus, trick_shots
4:40.787 trickshots O steady_shot Fluffy_Pillow 37.0/100: 37% focus steady_focus, trick_shots
4:42.172 trickshots J aimed_shot Fluffy_Pillow 55.8/100: 56% focus steady_focus, trick_shots
4:44.297 trickshots L multishot Fluffy_Pillow 34.2/100: 34% focus precise_shots, steady_focus
4:45.486 trickshots K rapid_fire Fluffy_Pillow 21.8/100: 22% focus steady_focus, trick_shots
4:47.314 trickshots L multishot Fluffy_Pillow 40.3/100: 40% focus steady_focus
4:48.504 trickshots M kill_shot Fluffy_Pillow 27.9/100: 28% focus steady_focus, trick_shots
4:49.692 trickshots O steady_shot Fluffy_Pillow 25.4/100: 25% focus steady_focus, trick_shots
4:51.080 trickshots O steady_shot Fluffy_Pillow 44.2/100: 44% focus steady_focus, trick_shots
4:52.468 trickshots G double_tap Fluffy_Pillow 63.0/100: 63% focus steady_focus, trick_shots
4:53.658 trickshots J aimed_shot Fluffy_Pillow 70.5/100: 70% focus double_tap, steady_focus, trick_shots
4:55.636 trickshots L multishot Fluffy_Pillow 48.0/100: 48% focus precise_shots(2), steady_focus
4:56.824 trickshots O steady_shot Fluffy_Pillow 35.5/100: 36% focus precise_shots, steady_focus, trick_shots
4:58.209 trickshots J aimed_shot Fluffy_Pillow 54.3/100: 54% focus precise_shots, steady_focus, trick_shots
5:00.189 trickshots L multishot Fluffy_Pillow 31.8/100: 32% focus precise_shots(2), steady_focus
5:01.377 trickshots M kill_shot Fluffy_Pillow 19.3/100: 19% focus precise_shots, steady_focus, trick_shots
5:02.566 trickshots O steady_shot Fluffy_Pillow 16.9/100: 17% focus precise_shots, steady_focus, trick_shots
5:03.952 trickshots F steady_shot Fluffy_Pillow 35.6/100: 36% focus precise_shots, steady_focus, trick_shots
5:05.338 trickshots K rapid_fire Fluffy_Pillow 54.4/100: 54% focus precise_shots, steady_focus, trick_shots
5:07.219 trickshots L multishot Fluffy_Pillow 73.3/100: 73% focus precise_shots, steady_focus
5:08.406 trickshots J aimed_shot Fluffy_Pillow 60.8/100: 61% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
5:10.384 trickshots L multishot Fluffy_Pillow 73.4/100: 73% focus precise_shots, steady_focus, secrets_of_the_unblinking_vigil
5:11.572 trickshots J aimed_shot Fluffy_Pillow 60.9/100: 61% focus steady_focus, trick_shots
5:13.550 cds E potion Fluffy_Pillow 38.4/100: 38% focus precise_shots, steady_focus
5:13.550 trickshots L multishot Fluffy_Pillow 38.4/100: 38% focus precise_shots, steady_focus, potion_of_spectral_agility
5:14.737 trickshots M kill_shot Fluffy_Pillow 25.9/100: 26% focus steady_focus, trick_shots, potion_of_spectral_agility
5:15.923 trickshots O steady_shot Fluffy_Pillow 23.4/100: 23% focus steady_focus, trick_shots, potion_of_spectral_agility
5:17.308 trickshots F steady_shot Fluffy_Pillow 42.2/100: 42% focus steady_focus, trick_shots, potion_of_spectral_agility
5:18.694 trickshots J aimed_shot Fluffy_Pillow 60.9/100: 61% focus steady_focus, trick_shots, potion_of_spectral_agility
5:20.671 trickshots L multishot Fluffy_Pillow 38.5/100: 38% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:21.860 trickshots O steady_shot Fluffy_Pillow 26.0/100: 26% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:23.247 trickshots O steady_shot Fluffy_Pillow 44.8/100: 45% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:24.634 trickshots L multishot Fluffy_Pillow 63.5/100: 64% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:25.822 trickshots J aimed_shot Fluffy_Pillow 51.1/100: 51% focus steady_focus, trick_shots, potion_of_spectral_agility
5:27.800 trickshots L multishot Fluffy_Pillow 28.6/100: 29% focus lock_and_load, precise_shots(2), steady_focus, potion_of_spectral_agility
5:28.987 trickshots J aimed_shot Fluffy_Pillow 16.1/100: 16% focus lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:30.174 trickshots L multishot Fluffy_Pillow 23.6/100: 24% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:31.362 trickshots K rapid_fire Fluffy_Pillow 11.1/100: 11% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:33.189 trickshots L multishot Fluffy_Pillow 29.7/100: 30% focus precise_shots, steady_focus, potion_of_spectral_agility
5:34.377 trickshots M kill_shot Fluffy_Pillow 17.2/100: 17% focus steady_focus, trick_shots, potion_of_spectral_agility
5:35.564 trickshots O steady_shot Fluffy_Pillow 14.7/100: 15% focus steady_focus, trick_shots, potion_of_spectral_agility
5:36.952 trickshots F steady_shot Fluffy_Pillow 33.5/100: 34% focus steady_focus, trick_shots, potion_of_spectral_agility
5:38.337 trickshots J aimed_shot Fluffy_Pillow 52.3/100: 52% focus steady_focus, trick_shots, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Secrets of the Unblinking Vigil }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="secrets_ot_unblinking_vigil"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7014,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

serpentstalkers_trickery : 8302 dps, 3625 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8301.8 8301.8 14.0 / 0.169% 981.4 / 11.8% 818.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.1 9.9 Focus 0.00% 47.4 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
serpentstalkers_trickery 8302
Aimed Shot 2463 (2709) 29.7% (32.6%) 47.8 6.24sec 17007 11004 Direct 143.3 (157.2) 4212 8427 5163 22.6% (22.6%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.83 143.33 0.00 0.00 1.5456 0.0000 740132.67 1057205.51 29.99% 11003.58 11003.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.41% 110.95 78 149 4211.85 2524 9967 4214.90 3831 4553 467339 667548 29.99%
crit 22.59% 32.38 16 53 8426.76 5048 19934 8434.08 6509 10667 272793 389658 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:48.01
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 245 2.9% 0.0 0.00sec 0 0 Direct 13.8 4314 8645 5303 22.9%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.83 0.00 0.00 0.0000 0.0000 73350.71 104774.15 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.13% 10.67 2 18 4313.92 2524 9967 4351.06 3193 6572 46039 65762 29.99%
crit 22.87% 3.16 0 9 8644.84 5048 19934 8415.15 0 19934 27312 39012 29.15%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 373 4.5% 113.0 2.67sec 992 437 Direct 112.7 811 1622 994 22.6%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.96 112.72 0.00 0.00 2.2691 0.0000 112055.49 160060.06 29.99% 437.20 437.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.39% 87.24 63 116 810.76 774 1019 810.71 795 825 70729 101030 29.99%
crit 22.61% 25.48 12 42 1621.66 1548 2037 1621.51 1559 1722 41326 59030 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 138 1.7% 3.8 90.75sec 11019 0 Direct 3.7 9042 18083 11046 22.1%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.75 3.74 0.00 0.00 0.0000 0.0000 41343.00 41343.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.87% 2.92 0 4 9041.96 8937 9474 8970.02 0 9474 26361 26361 0.00%
crit 22.13% 0.83 0 4 18082.97 17875 18947 10759.17 0 18947 14982 14982 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 39 0.5% 21.8 13.51sec 544 0 Direct 21.8 445 891 544 22.2%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.82 21.82 0.00 0.00 0.0000 0.0000 11876.40 11876.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.83% 16.99 6 33 445.48 435 485 445.45 435 459 7567 7567 0.00%
crit 22.17% 4.84 0 13 890.81 871 969 883.64 0 969 4309 4309 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 82 1.0% 4.6 13.71sec 5402 4525 Direct 4.5 4248 9576 5440 22.5%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.59 4.55 0.00 0.00 1.1941 0.0000 24773.43 35386.37 29.99% 4524.83 4524.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.54% 3.53 0 7 4247.98 4065 4838 4234.44 0 4838 14986 21406 29.92%
crit 22.46% 1.02 0 4 9576.42 9146 10885 6562.88 0 10885 9787 13980 20.56%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:4.58
  • if_expr:buff.dead_eye.down
Master Marksman 328 3.9% 200.1 1.50sec 492 0 Periodic 330.5 298 0 298 0.0% 73.2%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 200.10 0.00 330.53 330.53 0.0000 2.0000 98452.21 98452.21 0.00% 148.93 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 330.53 230 424 297.73 37 2446 298.05 219 376 98452 98452 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 1624 19.6% 81.7 3.66sec 5972 5235 Direct 244.7 1627 3250 1995 22.7%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 81.75 244.73 0.00 0.00 1.1409 0.0000 488213.57 697364.27 29.99% 5234.69 5234.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.33% 189.26 134 238 1626.77 953 2194 1626.55 1512 1729 307888 439787 29.99%
crit 22.67% 55.47 30 86 3250.42 1905 4389 3250.75 2855 3531 180326 257578 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:74.41
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:7.33
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 731 8.8% 16.4 18.39sec 13377 7619 Periodic 362.3 495 989 607 22.6% 2.7%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.43 0.00 121.12 362.25 1.7558 0.2039 219735.44 313870.10 29.99% 7619.12 7619.12
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.36% 280.23 175 384 494.75 351 925 494.77 471 515 138641 198035 29.99%
crit 22.64% 82.02 41 126 988.67 703 1850 988.93 883 1110 81094 115835 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:16.43
  • if_expr:buff.trick_shots.remains>=execute_time
Serpent Sting 800 9.7% 0.0 0.00sec 0 0 Direct 47.7 509 1017 624 22.7%
Periodic 353.6 487 974 597 22.6% 87.3%

Stats Details: Serpent Sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 47.71 353.63 353.63 0.0000 2.2292 240810.00 240810.00 0.00% 305.48 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.33% 36.90 24 50 508.70 479 630 508.79 494 522 18770 18770 0.00%
crit 22.67% 10.82 1 22 1017.41 958 1261 1017.46 958 1190 11005 11005 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.42% 273.77 187 356 486.82 0 630 486.76 474 498 133279 133279 0.00%
crit 22.58% 79.86 49 118 973.58 0 1261 973.52 916 1012 77756 77756 0.00%

Action Details: Serpent Sting

  • id:271788
  • school:nature
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.165000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:271788
  • name:Serpent Sting
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Fire a shot that poisons your target, causing them to take {$s1=0} Nature damage instantly and an additional $o2 Nature damage over {$d=18 seconds}.
Shadowcore Oil Blast 44 0.5% 44.1 6.72sec 300 0 Direct 44.1 245 489 300 22.7%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.07 44.07 0.00 0.00 0.0000 0.0000 13236.37 13236.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.25% 34.05 19 54 244.70 239 266 244.72 241 250 8332 8332 0.00%
crit 22.75% 10.03 1 21 489.21 479 533 489.18 479 511 4905 4905 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 348 4.2% 66.7 4.50sec 1570 1165 Direct 67.6 1265 2528 1550 22.6%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.69 67.59 0.00 0.00 1.3478 0.0000 104743.72 149615.93 29.99% 1165.23 1165.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.44% 52.34 34 74 1264.63 1219 1605 1264.37 1234 1291 66192 94548 29.99%
crit 22.56% 15.25 5 31 2528.45 2439 3210 2527.87 2439 2655 38552 55068 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.26
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:50.73
Wild Spirits 30 (1087) 0.4% (13.0%) 3.0 120.64sec 109102 99277 Direct 8.9 (179.3) 810 1622 994 22.7% (22.7%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 8.91 0.00 0.00 1.0990 0.0000 8859.83 8859.83 0.00% 99276.51 99276.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.29% 6.89 2 9 809.84 776 910 809.92 776 846 5578 5578 0.00%
crit 22.71% 2.02 0 7 1621.89 1552 1820 1461.79 0 1820 3281 3281 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 1057 12.7% 56.8 4.51sec 5564 0 Direct 170.4 1511 3022 1854 22.8%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.79 170.37 0.00 0.00 0.0000 0.0000 315972.92 315972.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.25% 131.61 85 160 1510.81 1355 1699 1511.45 1487 1570 198852 198852 0.00%
crit 22.75% 38.76 20 58 3021.73 2711 3398 3022.86 2938 3182 117121 117121 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
serpentstalkers_trickery
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:serpentstalkers_trickery
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.77sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.59sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 0.00 0.00 0.00 0.9778 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.63
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:serpentstalkers_trickery
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:serpentstalkers_trickery
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 308.90sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.78sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.63% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.0s

Stack Uptimes

  • blood_fury_1:14.63%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.4sec 8.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.2s

Stack Uptimes

  • double_tap_1:8.28%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.9 0.2 30.2sec 29.5sec 1.8sec 5.41% 18.19% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 245.5s
  • trigger_min/max:1.8s / 245.5s
  • trigger_pct:8.06%
  • duration_min/max:0.0s / 11.4s

Stack Uptimes

  • lock_and_load_1:5.41%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.1sec 309.1sec 23.2sec 11.18% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.6s
  • trigger_min/max:300.0s / 332.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.18%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.3 7.6 7.4sec 6.3sec 2.9sec 38.70% 82.47% 3.8 (3.8) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 35.0s
  • trigger_min/max:0.9s / 14.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.5s

Stack Uptimes

  • precise_shots_1:33.34%
  • precise_shots_2:5.35%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 6.2 18.7 51.7sec 12.2sec 45.9sec 94.43% 0.00% 18.7 (18.7) 5.3

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 271.4s
  • trigger_min/max:4.0s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 267.5s

Stack Uptimes

  • steady_focus_1:94.43%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 65.1 16.7 4.6sec 3.7sec 4.1sec 88.77% 100.00% 16.7 (16.7) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.3s
  • trigger_min/max:0.9s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:88.77%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.1sec 19.00% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 19.7s

Stack Uptimes

  • trueshot_1:19.00%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.6sec 17.45% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.45%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.6 1.0 7.0 69.4s 47.1s 296.3s
double_tap_rapid_fire 0.9 0.0 5.0 97.9s 55.5s 245.6s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.87% 0.68% 1.70% 0.9s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7330.0012.6652.8060.0008.476
Aimed Shot1.2690.0016.82813.5333.88626.315
Kill Shot3.8280.00723.84912.7790.00027.490
Wild Spirits0.7830.0012.6971.3060.0004.700
Trueshot0.8400.0012.9731.5770.2724.974
Rapid Fire3.1390.00126.09142.44219.45581.421

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
serpentstalkers_trickery
steady_shot Focus 67.69 656.83 22.03% 9.70 20.03 2.96%
rapid_fire Focus 121.16 120.98 4.06% 1.00 0.18 0.15%
focus_regen Focus 644.15 1951.44 65.44% 3.03 19.27 0.98%
Trueshot Focus 208.27 252.93 8.48% 1.21 0.90 0.36%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.91 10.12 40.4 36.6 0.1 99.4
Usage Type Count Total Avg RPE APR
serpentstalkers_trickery
aimed_shot Focus 47.8 1364.9 28.5 28.5 596.0
kill_shot Focus 4.6 45.8 10.0 10.0 540.5
multishot Focus 81.7 1634.8 20.0 20.0 298.6

Statistics & Data Analysis

Fight Length
serpentstalkers_trickery Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
serpentstalkers_trickery Damage Per Second
Count 1323
Mean 8301.82
Minimum 7505.31
Maximum 9016.73
Spread ( max - min ) 1511.42
Range [ ( max - min ) / 2 * 100% ] 9.10%
Standard Deviation 259.7350
5th Percentile 7884.73
95th Percentile 8743.77
( 95th Percentile - 5th Percentile ) 859.05
Mean Distribution
Standard Deviation 7.1409
95.00% Confidence Interval ( 8287.83 - 8315.82 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3761
0.1 Scale Factor Error with Delta=300 576
0.05 Scale Factor Error with Delta=300 2304
0.01 Scale Factor Error with Delta=300 57590
Priority Target DPS
serpentstalkers_trickery Priority Target Damage Per Second
Count 1323
Mean 3625.17
Minimum 3228.94
Maximum 4075.71
Spread ( max - min ) 846.77
Range [ ( max - min ) / 2 * 100% ] 11.68%
Standard Deviation 131.0771
5th Percentile 3421.16
95th Percentile 3842.35
( 95th Percentile - 5th Percentile ) 421.19
Mean Distribution
Standard Deviation 3.6037
95.00% Confidence Interval ( 3618.11 - 3632.23 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5023
0.1 Scale Factor Error with Delta=300 147
0.05 Scale Factor Error with Delta=300 587
0.01 Scale Factor Error with Delta=300 14667
DPS(e)
serpentstalkers_trickery Damage Per Second (Effective)
Count 1323
Mean 8301.82
Minimum 7505.31
Maximum 9016.73
Spread ( max - min ) 1511.42
Range [ ( max - min ) / 2 * 100% ] 9.10%
Damage
serpentstalkers_trickery Damage
Count 1323
Mean 2493555.77
Minimum 1902207.05
Maximum 2986225.30
Spread ( max - min ) 1084018.25
Range [ ( max - min ) / 2 * 100% ] 21.74%
DTPS
serpentstalkers_trickery Damage Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
serpentstalkers_trickery Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
serpentstalkers_trickery Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
serpentstalkers_trickery Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
serpentstalkers_trickery Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
serpentstalkers_trickery Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
serpentstalkers_trickeryTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
serpentstalkers_trickery Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.76 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.26 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.63 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 48.01 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 16.43 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 74.41 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 4.58 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 7.33 multishot,if=focus>cost+action.aimed_shot.cost
O 50.73 steady_shot

Sample Sequence

0125789FHIDELJLJLJLKLJLOFJLJOLKLJLOFOLJLOJLKLOFJLOOOLJLGOOLKLJLOLOFJLJLOLJLJLKLOFJLO9OONJLOOKLNJLOOGNOJLOLJHIDLJLKLOFJLJLKLJLJOFLJLKLJLOFJLOOONJLGKLOFJLL9JLOOLJLKLOOJLOONOJLOLKLOFJLOLNOJLOFGKLJLOLHIDJLOFJLJLKLJOFLJLKLJOF9LMOLJLOOOKLJLMOFGLJLOJLKLMOFJELJLOMOJLOFKLJLJLMOF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask serpentstalkers_trickery 100.0/100: 100% focus
Pre precombat 1 augmentation serpentstalkers_trickery 100.0/100: 100% focus
Pre precombat 2 food serpentstalkers_trickery 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.484 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.401 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.401 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.317 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, lock_and_load, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.234 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.148 trickshots J aimed_shot enemy2 91.3/100: 91% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.064 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.979 trickshots J aimed_shot enemy3 58.2/100: 58% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:07.893 trickshots L multishot Fluffy_Pillow 34.5/100: 35% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:08.809 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.230 trickshots L multishot Fluffy_Pillow 53.4/100: 53% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.145 trickshots J aimed_shot Fluffy_Pillow 44.6/100: 45% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.061 trickshots L multishot Fluffy_Pillow 21.0/100: 21% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:12.975 trickshots O steady_shot Fluffy_Pillow 12.2/100: 12% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.043 trickshots F steady_shot Fluffy_Pillow 40.4/100: 40% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:15.111 trickshots J aimed_shot enemy2 68.6/100: 69% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:16.027 trickshots L multishot Fluffy_Pillow 44.9/100: 45% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:16.943 trickshots J aimed_shot enemy3 36.2/100: 36% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:17.858 trickshots O steady_shot Fluffy_Pillow 12.5/100: 12% focus bloodlust, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:18.926 trickshots L multishot Fluffy_Pillow 40.7/100: 41% focus bloodlust, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:19.842 trickshots K rapid_fire Fluffy_Pillow 32.0/100: 32% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:21.338 trickshots L multishot Fluffy_Pillow 61.4/100: 61% focus bloodlust, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:22.254 trickshots J aimed_shot Fluffy_Pillow 51.9/100: 52% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:23.779 trickshots L multishot Fluffy_Pillow 29.5/100: 29% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:24.692 trickshots O steady_shot Fluffy_Pillow 17.0/100: 17% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:25.758 trickshots F steady_shot Fluffy_Pillow 35.7/100: 36% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:26.823 trickshots O steady_shot Fluffy_Pillow 54.5/100: 55% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:27.891 trickshots L multishot Fluffy_Pillow 73.3/100: 73% focus bloodlust, precise_shots, steady_focus, trick_shots
0:28.805 trickshots J aimed_shot enemy2 60.8/100: 61% focus bloodlust, steady_focus, trick_shots
0:30.328 trickshots L multishot Fluffy_Pillow 38.4/100: 38% focus bloodlust, precise_shots, steady_focus
0:31.243 trickshots O steady_shot Fluffy_Pillow 25.9/100: 26% focus bloodlust, steady_focus, trick_shots
0:32.310 trickshots J aimed_shot enemy3 44.7/100: 45% focus bloodlust, steady_focus, trick_shots
0:33.836 trickshots L multishot Fluffy_Pillow 22.2/100: 22% focus bloodlust, precise_shots(2), steady_focus
0:34.750 trickshots K rapid_fire Fluffy_Pillow 9.7/100: 10% focus bloodlust, precise_shots, steady_focus, trick_shots
0:36.139 trickshots L multishot Fluffy_Pillow 28.2/100: 28% focus bloodlust, precise_shots, steady_focus
0:37.056 trickshots O steady_shot Fluffy_Pillow 15.7/100: 16% focus bloodlust, steady_focus, trick_shots
0:38.123 trickshots F steady_shot Fluffy_Pillow 34.5/100: 34% focus bloodlust, steady_focus, trick_shots
0:39.192 trickshots J aimed_shot Fluffy_Pillow 53.3/100: 53% focus bloodlust, steady_focus, trick_shots
0:40.715 trickshots L multishot Fluffy_Pillow 30.8/100: 31% focus bloodlust, precise_shots(2), steady_focus
0:41.629 trickshots O steady_shot Fluffy_Pillow 17.1/100: 17% focus precise_shots, steady_focus, trick_shots
0:43.014 trickshots O steady_shot Fluffy_Pillow 35.9/100: 36% focus precise_shots, steady_focus, trick_shots
0:44.402 trickshots O steady_shot Fluffy_Pillow 54.7/100: 55% focus precise_shots, steady_focus, trick_shots
0:45.788 trickshots L multishot Fluffy_Pillow 73.5/100: 73% focus precise_shots, steady_focus, trick_shots
0:46.974 trickshots J aimed_shot enemy2 61.0/100: 61% focus steady_focus, trick_shots
0:49.022 trickshots L multishot Fluffy_Pillow 38.9/100: 39% focus precise_shots(2), steady_focus
0:50.210 trickshots G double_tap Fluffy_Pillow 26.5/100: 26% focus precise_shots, steady_focus, trick_shots
0:51.398 trickshots O steady_shot Fluffy_Pillow 34.0/100: 34% focus double_tap, precise_shots, steady_focus, trick_shots
0:52.785 trickshots O steady_shot Fluffy_Pillow 52.8/100: 53% focus double_tap, precise_shots, steady_focus, trick_shots
0:54.172 trickshots L multishot Fluffy_Pillow 71.5/100: 72% focus double_tap, precise_shots, steady_focus, trick_shots
0:55.360 trickshots K rapid_fire Fluffy_Pillow 59.0/100: 59% focus double_tap, steady_focus, trick_shots
0:57.251 trickshots L multishot Fluffy_Pillow 85.0/100: 85% focus steady_focus
0:58.439 trickshots J aimed_shot enemy3 72.5/100: 73% focus steady_focus, trick_shots
1:00.418 trickshots L multishot Fluffy_Pillow 50.1/100: 50% focus precise_shots(2), steady_focus
1:01.607 trickshots O steady_shot Fluffy_Pillow 37.6/100: 38% focus precise_shots, steady_focus, trick_shots
1:02.994 trickshots L multishot Fluffy_Pillow 56.4/100: 56% focus precise_shots, steady_focus, trick_shots
1:04.183 trickshots O steady_shot Fluffy_Pillow 43.9/100: 44% focus steady_focus, trick_shots
1:05.570 trickshots F steady_shot Fluffy_Pillow 62.7/100: 63% focus steady_focus, trick_shots
1:06.956 trickshots J aimed_shot Fluffy_Pillow 81.4/100: 81% focus steady_focus, trick_shots
1:08.934 trickshots L multishot Fluffy_Pillow 59.0/100: 59% focus precise_shots, steady_focus
1:10.122 trickshots J aimed_shot enemy2 46.5/100: 46% focus lock_and_load, steady_focus, trick_shots
1:11.310 trickshots L multishot Fluffy_Pillow 54.0/100: 54% focus precise_shots(2), steady_focus
1:12.500 trickshots O steady_shot Fluffy_Pillow 41.5/100: 42% focus precise_shots, steady_focus, trick_shots
1:13.887 trickshots L multishot Fluffy_Pillow 60.3/100: 60% focus precise_shots, steady_focus, trick_shots
1:15.075 trickshots J aimed_shot enemy3 47.8/100: 48% focus lock_and_load, steady_focus, trick_shots
1:16.262 trickshots L multishot Fluffy_Pillow 55.3/100: 55% focus precise_shots, steady_focus
1:17.451 trickshots J aimed_shot Fluffy_Pillow 42.9/100: 43% focus steady_focus, trick_shots
1:19.427 trickshots L multishot Fluffy_Pillow 20.4/100: 20% focus precise_shots(2), steady_focus
1:20.615 trickshots K rapid_fire Fluffy_Pillow 7.9/100: 8% focus precise_shots, steady_focus, trick_shots
1:22.305 trickshots L multishot Fluffy_Pillow 25.4/100: 25% focus precise_shots
1:23.577 trickshots O steady_shot Fluffy_Pillow 13.0/100: 13% focus trick_shots
1:25.061 trickshots F steady_shot Fluffy_Pillow 31.7/100: 32% focus trick_shots
1:26.545 trickshots J aimed_shot enemy2 50.5/100: 51% focus steady_focus, trick_shots
1:28.523 trickshots L multishot Fluffy_Pillow 28.0/100: 28% focus precise_shots, steady_focus
1:29.711 trickshots O steady_shot Fluffy_Pillow 15.6/100: 16% focus steady_focus, trick_shots
1:31.098 default 9 use_items Fluffy_Pillow 34.3/100: 34% focus steady_focus, trick_shots
1:31.098 trickshots O steady_shot Fluffy_Pillow 34.3/100: 34% focus steady_focus, trick_shots
1:32.485 trickshots O steady_shot Fluffy_Pillow 53.1/100: 53% focus steady_focus, trick_shots
1:33.872 trickshots N multishot Fluffy_Pillow 71.9/100: 72% focus steady_focus, trick_shots
1:35.062 trickshots J aimed_shot enemy3 59.4/100: 59% focus steady_focus, trick_shots
1:37.044 trickshots L multishot Fluffy_Pillow 37.0/100: 37% focus precise_shots(2), steady_focus
1:38.233 trickshots O steady_shot Fluffy_Pillow 24.5/100: 25% focus precise_shots, steady_focus, trick_shots
1:39.619 trickshots O steady_shot Fluffy_Pillow 43.3/100: 43% focus precise_shots, steady_focus, trick_shots
1:41.005 trickshots K rapid_fire Fluffy_Pillow 62.0/100: 62% focus precise_shots, steady_focus, trick_shots
1:42.702 trickshots L multishot Fluffy_Pillow 79.8/100: 80% focus precise_shots, steady_focus
1:43.890 trickshots N multishot Fluffy_Pillow 67.3/100: 67% focus steady_focus, trick_shots
1:45.079 trickshots J aimed_shot Fluffy_Pillow 54.8/100: 55% focus steady_focus, trick_shots
1:47.058 trickshots L multishot Fluffy_Pillow 32.4/100: 32% focus precise_shots, steady_focus
1:48.246 trickshots O steady_shot Fluffy_Pillow 19.9/100: 20% focus steady_focus, trick_shots
1:49.632 trickshots O steady_shot Fluffy_Pillow 38.6/100: 39% focus steady_focus, trick_shots
1:51.018 trickshots G double_tap Fluffy_Pillow 57.4/100: 57% focus steady_focus, trick_shots
1:52.206 trickshots N multishot Fluffy_Pillow 64.9/100: 65% focus double_tap, steady_focus, trick_shots
1:53.395 trickshots O steady_shot Fluffy_Pillow 52.5/100: 52% focus double_tap, steady_focus, trick_shots
1:54.781 trickshots J aimed_shot enemy2 71.2/100: 71% focus double_tap, steady_focus, trick_shots
1:56.761 trickshots L multishot Fluffy_Pillow 48.8/100: 49% focus precise_shots(2), steady_focus
1:57.947 trickshots O steady_shot Fluffy_Pillow 36.3/100: 36% focus precise_shots, steady_focus, trick_shots
1:59.335 trickshots L multishot Fluffy_Pillow 55.1/100: 55% focus precise_shots, steady_focus, trick_shots
2:00.523 trickshots J aimed_shot enemy3 42.6/100: 43% focus lock_and_load, steady_focus, trick_shots
2:01.711 trickshots H wild_spirits Fluffy_Pillow 50.1/100: 50% focus precise_shots(2), steady_focus
2:02.900 trickshots I trueshot Fluffy_Pillow 57.6/100: 58% focus precise_shots(2), steady_focus
2:02.900 cds D blood_fury Fluffy_Pillow 57.6/100: 58% focus precise_shots(2), steady_focus, trueshot
2:02.900 trickshots L multishot Fluffy_Pillow 57.6/100: 58% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:04.090 trickshots J aimed_shot Fluffy_Pillow 48.9/100: 49% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:05.280 trickshots L multishot Fluffy_Pillow 25.2/100: 25% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:06.468 trickshots K rapid_fire Fluffy_Pillow 16.2/100: 16% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits
2:08.508 trickshots L multishot Fluffy_Pillow 43.3/100: 43% focus blood_fury, precise_shots, trueshot, wild_spirits
2:09.783 trickshots O steady_shot Fluffy_Pillow 34.6/100: 35% focus blood_fury, trick_shots, trueshot, wild_spirits
2:11.266 trickshots F steady_shot Fluffy_Pillow 62.8/100: 63% focus blood_fury, trick_shots, trueshot, wild_spirits
2:12.749 trickshots J aimed_shot enemy2 90.9/100: 91% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:13.937 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:15.125 trickshots J aimed_shot enemy3 58.2/100: 58% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:16.314 trickshots L multishot Fluffy_Pillow 34.5/100: 34% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:17.503 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:19.352 trickshots L multishot Fluffy_Pillow 53.3/100: 53% focus precise_shots, steady_focus, trueshot, wild_spirits
2:20.543 trickshots J aimed_shot Fluffy_Pillow 44.6/100: 45% focus steady_focus, trick_shots, trueshot, wild_spirits
2:21.731 trickshots L multishot Fluffy_Pillow 20.9/100: 21% focus precise_shots, steady_focus, trueshot
2:22.918 trickshots J aimed_shot enemy2 11.0/100: 11% focus lock_and_load, steady_focus, trick_shots
2:24.105 trickshots O steady_shot Fluffy_Pillow 18.5/100: 19% focus precise_shots(2), steady_focus
2:25.490 trickshots F steady_shot Fluffy_Pillow 37.3/100: 37% focus lock_and_load, precise_shots(2), steady_focus
2:26.878 trickshots L multishot Fluffy_Pillow 56.1/100: 56% focus lock_and_load, precise_shots(2), steady_focus
2:28.068 trickshots J aimed_shot enemy3 43.6/100: 44% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:29.256 trickshots L multishot Fluffy_Pillow 51.1/100: 51% focus precise_shots(2), steady_focus
2:30.445 trickshots K rapid_fire Fluffy_Pillow 38.6/100: 39% focus precise_shots, steady_focus, trick_shots
2:32.243 trickshots L multishot Fluffy_Pillow 57.0/100: 57% focus precise_shots, steady_focus
2:33.432 trickshots J aimed_shot Fluffy_Pillow 44.6/100: 45% focus steady_focus, trick_shots
2:35.412 trickshots L multishot Fluffy_Pillow 22.1/100: 22% focus precise_shots, steady_focus
2:36.601 trickshots O steady_shot Fluffy_Pillow 9.6/100: 10% focus steady_focus, trick_shots
2:37.986 trickshots F steady_shot Fluffy_Pillow 28.4/100: 28% focus steady_focus, trick_shots
2:39.374 trickshots J aimed_shot enemy2 47.2/100: 47% focus steady_focus, trick_shots
2:41.350 trickshots L multishot Fluffy_Pillow 24.7/100: 25% focus precise_shots, steady_focus
2:42.538 trickshots O steady_shot Fluffy_Pillow 12.2/100: 12% focus steady_focus, trick_shots
2:43.924 trickshots O steady_shot Fluffy_Pillow 31.0/100: 31% focus steady_focus, trick_shots
2:45.310 trickshots O steady_shot Fluffy_Pillow 49.7/100: 50% focus steady_focus, trick_shots
2:46.696 trickshots N multishot Fluffy_Pillow 68.5/100: 69% focus steady_focus, trick_shots
2:47.882 trickshots J aimed_shot enemy3 56.0/100: 56% focus steady_focus, trick_shots
2:49.859 trickshots L multishot Fluffy_Pillow 33.5/100: 34% focus precise_shots, steady_focus
2:51.048 trickshots G double_tap Fluffy_Pillow 21.0/100: 21% focus steady_focus, trick_shots
2:52.236 trickshots K rapid_fire Fluffy_Pillow 28.6/100: 29% focus double_tap, steady_focus, trick_shots
2:54.209 trickshots L multishot Fluffy_Pillow 55.1/100: 55% focus steady_focus
2:55.397 trickshots O steady_shot Fluffy_Pillow 42.6/100: 43% focus steady_focus, trick_shots
2:56.783 trickshots F steady_shot Fluffy_Pillow 61.3/100: 61% focus steady_focus, trick_shots
2:58.171 trickshots J aimed_shot Fluffy_Pillow 80.1/100: 80% focus lock_and_load, steady_focus, trick_shots
2:59.360 trickshots L multishot Fluffy_Pillow 87.7/100: 88% focus precise_shots(2), steady_focus
3:00.548 trickshots L multishot Fluffy_Pillow 75.2/100: 75% focus precise_shots, steady_focus, trick_shots
3:01.737 default 9 use_items Fluffy_Pillow 62.7/100: 63% focus steady_focus, trick_shots
3:01.737 trickshots J aimed_shot enemy2 62.7/100: 63% focus steady_focus, trick_shots
3:03.715 trickshots L multishot Fluffy_Pillow 40.2/100: 40% focus precise_shots(2), steady_focus
3:04.903 trickshots O steady_shot Fluffy_Pillow 27.7/100: 28% focus precise_shots, steady_focus, trick_shots
3:06.289 trickshots O steady_shot Fluffy_Pillow 46.5/100: 47% focus precise_shots, steady_focus, trick_shots
3:07.676 trickshots L multishot Fluffy_Pillow 65.3/100: 65% focus precise_shots, steady_focus, trick_shots
3:08.863 trickshots J aimed_shot enemy3 52.8/100: 53% focus steady_focus, trick_shots
3:10.840 trickshots L multishot Fluffy_Pillow 30.3/100: 30% focus precise_shots(2), steady_focus
3:12.027 trickshots K rapid_fire Fluffy_Pillow 17.8/100: 18% focus precise_shots, steady_focus, trick_shots
3:14.015 trickshots L multishot Fluffy_Pillow 37.4/100: 37% focus precise_shots, steady_focus
3:15.204 trickshots O steady_shot Fluffy_Pillow 24.9/100: 25% focus steady_focus, trick_shots
3:16.592 trickshots O steady_shot Fluffy_Pillow 43.7/100: 44% focus steady_focus, trick_shots
3:17.978 trickshots J aimed_shot Fluffy_Pillow 62.5/100: 62% focus steady_focus, trick_shots
3:19.956 trickshots L multishot Fluffy_Pillow 40.0/100: 40% focus precise_shots, steady_focus
3:21.146 trickshots O steady_shot Fluffy_Pillow 27.5/100: 28% focus steady_focus, trick_shots
3:22.533 trickshots O steady_shot Fluffy_Pillow 46.3/100: 46% focus steady_focus, trick_shots
3:23.918 trickshots N multishot Fluffy_Pillow 65.1/100: 65% focus steady_focus, trick_shots
3:25.108 trickshots O steady_shot Fluffy_Pillow 52.6/100: 53% focus steady_focus, trick_shots
3:26.495 trickshots J aimed_shot enemy2 71.4/100: 71% focus steady_focus, trick_shots
3:28.588 trickshots L multishot Fluffy_Pillow 49.6/100: 50% focus precise_shots(2), steady_focus
3:29.778 trickshots O steady_shot Fluffy_Pillow 37.2/100: 37% focus precise_shots, steady_focus, trick_shots
3:31.164 trickshots L multishot Fluffy_Pillow 56.0/100: 56% focus precise_shots, steady_focus, trick_shots
3:32.352 trickshots K rapid_fire Fluffy_Pillow 43.5/100: 43% focus steady_focus, trick_shots
3:34.227 trickshots L multishot Fluffy_Pillow 62.3/100: 62% focus steady_focus
3:35.416 trickshots O steady_shot Fluffy_Pillow 49.9/100: 50% focus steady_focus, trick_shots
3:36.803 trickshots F steady_shot Fluffy_Pillow 68.6/100: 69% focus steady_focus, trick_shots
3:38.188 trickshots J aimed_shot enemy3 87.4/100: 87% focus steady_focus, trick_shots
3:40.166 trickshots L multishot Fluffy_Pillow 64.9/100: 65% focus precise_shots(2), steady_focus
3:41.355 trickshots O steady_shot Fluffy_Pillow 52.5/100: 52% focus precise_shots, steady_focus, trick_shots
3:42.741 trickshots L multishot Fluffy_Pillow 71.2/100: 71% focus precise_shots, steady_focus, trick_shots
3:43.932 trickshots N multishot Fluffy_Pillow 58.8/100: 59% focus steady_focus, trick_shots
3:45.120 trickshots O steady_shot Fluffy_Pillow 46.3/100: 46% focus steady_focus, trick_shots
3:46.506 trickshots J aimed_shot Fluffy_Pillow 65.1/100: 65% focus steady_focus, trick_shots
3:48.486 trickshots L multishot Fluffy_Pillow 42.6/100: 43% focus precise_shots(2), steady_focus
3:49.674 trickshots O steady_shot Fluffy_Pillow 30.1/100: 30% focus precise_shots, steady_focus, trick_shots
3:51.061 trickshots F steady_shot Fluffy_Pillow 48.9/100: 49% focus precise_shots, steady_focus, trick_shots
3:52.449 trickshots G double_tap Fluffy_Pillow 67.7/100: 68% focus precise_shots, steady_focus, trick_shots
3:53.637 trickshots K rapid_fire Fluffy_Pillow 75.2/100: 75% focus double_tap, precise_shots, steady_focus, trick_shots
3:55.634 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus precise_shots, steady_focus
3:56.822 trickshots J aimed_shot enemy2 87.5/100: 88% focus steady_focus, trick_shots
3:58.800 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots(2), steady_focus
3:59.989 trickshots O steady_shot Fluffy_Pillow 52.6/100: 53% focus precise_shots, steady_focus, trick_shots
4:01.377 trickshots L multishot Fluffy_Pillow 71.3/100: 71% focus precise_shots, steady_focus, trick_shots
4:02.564 trickshots H wild_spirits Fluffy_Pillow 58.8/100: 59% focus steady_focus, trick_shots
4:03.755 trickshots I trueshot Fluffy_Pillow 66.4/100: 66% focus steady_focus, trick_shots
4:03.755 cds D blood_fury Fluffy_Pillow 66.4/100: 66% focus steady_focus, trick_shots, trueshot
4:03.755 trickshots J aimed_shot enemy3 66.4/100: 66% focus blood_fury, steady_focus, trick_shots, trueshot
4:05.179 trickshots L multishot Fluffy_Pillow 44.9/100: 45% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:06.366 trickshots O steady_shot Fluffy_Pillow 36.2/100: 36% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:07.752 trickshots F steady_shot Fluffy_Pillow 64.1/100: 64% focus blood_fury, trick_shots, trueshot, wild_spirits
4:09.236 trickshots J aimed_shot Fluffy_Pillow 92.3/100: 92% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:10.424 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:11.612 trickshots J aimed_shot enemy2 58.2/100: 58% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:12.800 trickshots L multishot Fluffy_Pillow 34.5/100: 34% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:13.990 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:15.707 trickshots L multishot Fluffy_Pillow 51.1/100: 51% focus blood_fury, steady_focus, trueshot, wild_spirits
4:16.895 trickshots J aimed_shot enemy3 42.3/100: 42% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:18.084 trickshots O steady_shot Fluffy_Pillow 18.6/100: 19% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:19.471 trickshots F steady_shot Fluffy_Pillow 46.8/100: 47% focus precise_shots, steady_focus, trueshot, wild_spirits
4:20.858 trickshots L multishot Fluffy_Pillow 75.0/100: 75% focus precise_shots, steady_focus, trueshot, wild_spirits
4:22.047 trickshots J aimed_shot Fluffy_Pillow 66.3/100: 66% focus steady_focus, trick_shots, trueshot
4:23.235 trickshots L multishot Fluffy_Pillow 42.5/100: 43% focus precise_shots(2), steady_focus, trueshot
4:24.422 trickshots K rapid_fire Fluffy_Pillow 30.6/100: 31% focus precise_shots, steady_focus, trick_shots
4:26.301 trickshots L multishot Fluffy_Pillow 49.5/100: 49% focus precise_shots, steady_focus
4:27.491 trickshots J aimed_shot enemy2 37.0/100: 37% focus steady_focus, trick_shots
4:29.471 trickshots O steady_shot Fluffy_Pillow 14.5/100: 15% focus precise_shots(2), steady_focus
4:30.856 trickshots F steady_shot Fluffy_Pillow 33.3/100: 33% focus precise_shots(2), steady_focus
4:32.243 default 9 use_items Fluffy_Pillow 52.1/100: 52% focus precise_shots(2), steady_focus
4:32.243 trickshots L multishot Fluffy_Pillow 52.1/100: 52% focus precise_shots(2), steady_focus
4:33.430 trickshots M kill_shot Fluffy_Pillow 39.6/100: 40% focus precise_shots, steady_focus, trick_shots
4:34.619 trickshots O steady_shot Fluffy_Pillow 37.1/100: 37% focus precise_shots, steady_focus, trick_shots
4:36.006 trickshots L multishot Fluffy_Pillow 55.9/100: 56% focus precise_shots, steady_focus, trick_shots
4:37.196 trickshots J aimed_shot enemy3 43.4/100: 43% focus steady_focus, trick_shots
4:39.174 trickshots L multishot Fluffy_Pillow 21.0/100: 21% focus precise_shots(2), steady_focus
4:40.363 trickshots O steady_shot Fluffy_Pillow 8.5/100: 8% focus precise_shots, steady_focus, trick_shots
4:41.749 trickshots O steady_shot Fluffy_Pillow 27.3/100: 27% focus precise_shots, steady_focus, trick_shots
4:43.136 trickshots O steady_shot Fluffy_Pillow 46.0/100: 46% focus precise_shots, steady_focus, trick_shots
4:44.521 trickshots K rapid_fire Fluffy_Pillow 64.8/100: 65% focus precise_shots, steady_focus, trick_shots
4:46.310 trickshots L multishot Fluffy_Pillow 83.1/100: 83% focus precise_shots, steady_focus
4:47.498 trickshots J aimed_shot Fluffy_Pillow 70.6/100: 71% focus steady_focus, trick_shots
4:49.476 trickshots L multishot Fluffy_Pillow 48.2/100: 48% focus precise_shots(2), steady_focus
4:50.665 trickshots M kill_shot Fluffy_Pillow 35.7/100: 36% focus precise_shots, steady_focus, trick_shots
4:51.853 trickshots O steady_shot Fluffy_Pillow 33.2/100: 33% focus precise_shots, steady_focus, trick_shots
4:53.240 trickshots F steady_shot Fluffy_Pillow 52.0/100: 52% focus precise_shots, steady_focus, trick_shots
4:54.625 trickshots G double_tap Fluffy_Pillow 70.7/100: 71% focus precise_shots, steady_focus, trick_shots
4:55.813 trickshots L multishot Fluffy_Pillow 78.3/100: 78% focus double_tap, precise_shots, steady_focus, trick_shots
4:57.002 trickshots J aimed_shot enemy2 65.8/100: 66% focus double_tap, steady_focus, trick_shots
4:58.981 trickshots L multishot Fluffy_Pillow 43.3/100: 43% focus precise_shots, steady_focus
5:00.170 trickshots O steady_shot Fluffy_Pillow 30.8/100: 31% focus steady_focus, trick_shots
5:01.557 trickshots J aimed_shot enemy3 49.6/100: 50% focus steady_focus, trick_shots
5:03.536 trickshots L multishot Fluffy_Pillow 27.1/100: 27% focus precise_shots(2), steady_focus
5:04.725 trickshots K rapid_fire Fluffy_Pillow 14.7/100: 15% focus precise_shots, steady_focus, trick_shots
5:06.562 trickshots L multishot Fluffy_Pillow 33.3/100: 33% focus precise_shots, steady_focus
5:07.751 trickshots M kill_shot Fluffy_Pillow 20.8/100: 21% focus steady_focus, trick_shots
5:08.940 trickshots O steady_shot Fluffy_Pillow 18.3/100: 18% focus steady_focus, trick_shots
5:10.325 trickshots F steady_shot Fluffy_Pillow 36.8/100: 37% focus lock_and_load, trick_shots
5:11.809 trickshots J aimed_shot Fluffy_Pillow 55.6/100: 56% focus lock_and_load, steady_focus, trick_shots
5:12.999 cds E potion Fluffy_Pillow 63.1/100: 63% focus precise_shots, steady_focus
5:12.999 trickshots L multishot Fluffy_Pillow 63.1/100: 63% focus precise_shots, steady_focus, potion_of_spectral_agility
5:14.188 trickshots J aimed_shot enemy2 50.7/100: 51% focus steady_focus, trick_shots, potion_of_spectral_agility
5:16.168 trickshots L multishot Fluffy_Pillow 28.2/100: 28% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:17.356 trickshots O steady_shot Fluffy_Pillow 15.7/100: 16% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:18.745 trickshots M kill_shot Fluffy_Pillow 34.5/100: 35% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:19.932 trickshots O steady_shot Fluffy_Pillow 32.0/100: 32% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:21.319 trickshots J aimed_shot enemy3 50.8/100: 51% focus lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:22.509 trickshots L multishot Fluffy_Pillow 58.3/100: 58% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:23.696 trickshots O steady_shot Fluffy_Pillow 45.8/100: 46% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:25.081 trickshots F steady_shot Fluffy_Pillow 64.6/100: 65% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:26.467 trickshots K rapid_fire Fluffy_Pillow 83.4/100: 83% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:28.271 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus precise_shots, steady_focus, potion_of_spectral_agility
5:29.459 trickshots J aimed_shot Fluffy_Pillow 87.5/100: 88% focus steady_focus, trick_shots, potion_of_spectral_agility
5:31.437 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus, potion_of_spectral_agility
5:32.626 trickshots J aimed_shot enemy2 52.6/100: 53% focus steady_focus, trick_shots, potion_of_spectral_agility
5:34.605 trickshots L multishot Fluffy_Pillow 30.1/100: 30% focus precise_shots, steady_focus, potion_of_spectral_agility
5:35.793 trickshots M kill_shot Fluffy_Pillow 17.6/100: 18% focus steady_focus, trick_shots, potion_of_spectral_agility
5:36.982 trickshots O steady_shot Fluffy_Pillow 15.1/100: 15% focus steady_focus, trick_shots, potion_of_spectral_agility
5:38.367 trickshots F steady_shot Fluffy_Pillow 33.9/100: 34% focus steady_focus, trick_shots

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Serpentstalker's Trickery }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="serpentstalkers_trickery"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7013,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

soulforge_embers : 8069 dps, 3914 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8068.9 8068.9 12.4 / 0.154% 870.6 / 10.8% 837.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.6 9.4 Focus 0.00% 47.7 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
soulforge_embers 8069
Aimed Shot 2403 (2636) 29.8% (32.7%) 46.5 6.40sec 17006 10967 Direct 139.4 (152.6) 4223 8419 5177 22.7% (22.7%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.54 139.41 0.00 0.00 1.5507 0.0000 721710.33 1030891.04 29.99% 10967.08 10967.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.26% 107.71 75 144 4222.97 2524 9967 4225.58 3917 4645 454917 649803 29.99%
crit 22.74% 31.70 13 56 8418.68 5048 19934 8428.15 6550 11070 266794 381088 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:46.74
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 233 2.9% 0.0 0.00sec 0 0 Direct 13.2 4309 8640 5280 22.4%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.20 0.00 0.00 0.0000 0.0000 69696.22 99554.08 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.56% 10.23 2 20 4308.90 2524 9967 4342.39 3020 7052 44099 62990 29.99%
crit 22.44% 2.96 0 10 8639.63 5048 19934 8404.35 0 18806 25598 36564 28.72%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 376 4.7% 114.0 2.65sec 994 436 Direct 113.7 812 1624 996 22.6%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.97 113.74 0.00 0.00 2.2776 0.0000 113232.07 161740.69 29.99% 436.23 436.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.40% 88.04 61 114 812.11 774 1019 812.03 797 826 71497 102126 29.99%
crit 22.60% 25.70 11 44 1623.95 1548 2037 1623.81 1566 1703 41735 59615 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 137 1.7% 3.8 90.75sec 10971 0 Direct 3.7 9038 18059 11013 21.9%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.75 3.74 0.00 0.00 0.0000 0.0000 41172.22 41172.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.13% 2.92 0 4 9038.16 8937 9474 8962.56 0 9474 26404 26404 0.00%
crit 21.87% 0.82 0 4 18059.43 17875 18947 10835.58 0 18947 14769 14769 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.5% 21.8 13.26sec 548 0 Direct 21.8 446 892 548 22.8%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.82 21.82 0.00 0.00 0.0000 0.0000 11948.81 11948.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.21% 16.85 6 35 445.92 435 485 445.89 435 463 7512 7512 0.00%
crit 22.79% 4.97 0 13 892.05 871 969 887.21 0 969 4437 4437 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 74 0.9% 4.2 14.62sec 5386 4470 Direct 4.1 4244 9549 5449 22.6%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.17 4.13 0.00 0.00 1.2050 0.0000 22460.59 32082.71 29.99% 4469.77 4469.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.41% 3.19 0 7 4244.40 4065 4838 4196.02 0 4661 13557 19365 29.72%
crit 22.59% 0.93 0 4 9549.45 9146 10885 6046.88 0 10885 8903 12718 19.00%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [O]:4.17
  • if_expr:buff.dead_eye.down
Master Marksman 308 3.8% 180.4 1.66sec 513 0 Periodic 309.5 299 0 299 0.0% 68.6%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 180.37 0.00 309.46 309.46 0.0000 2.0000 92601.29 92601.29 0.00% 149.62 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 309.46 219 406 299.22 37 2632 299.50 220 395 92601 92601 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 1541 19.1% 76.5 3.90sec 6054 5297 Direct 229.0 1649 3299 2022 22.6%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 76.50 228.96 0.00 0.00 1.1429 0.0000 463087.70 661474.47 29.99% 5296.91 5296.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.37% 177.15 129 222 1649.14 953 2194 1649.17 1527 1741 292152 417310 29.99%
crit 22.63% 51.80 29 80 3299.03 1905 4389 3299.40 2918 3662 170936 244164 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [N]:71.59
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [P]:4.90
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 714 8.9% 15.8 19.05sec 13568 7704 Periodic 354.0 494 989 606 22.7% 2.6%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.81 0.00 118.41 354.04 1.7612 0.2016 214569.37 306490.88 29.99% 7704.19 7704.19
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.30% 273.68 176 413 493.55 351 925 493.55 475 516 135079 192946 29.99%
crit 22.70% 80.36 44 122 989.10 703 1850 988.75 861 1108 79491 113545 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [M]:15.81
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 43 0.5% 43.3 6.93sec 301 0 Direct 43.3 245 491 301 22.7%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.32 43.32 0.00 0.00 0.0000 0.0000 13047.42 13047.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.27% 33.47 19 57 245.39 239 266 245.40 241 251 8214 8214 0.00%
crit 22.73% 9.85 2 21 490.93 479 533 490.94 479 523 4833 4833 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Soulforge Embers 1144 14.2% 14.4 21.43sec 23853 0 Periodic 350.4 801 1601 982 22.6% 56.3%

Stats Details: Soulforge Embers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.43 0.00 350.38 350.38 0.0000 1.4501 344147.75 344147.75 0.00% 677.35 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.36% 271.04 203 343 801.20 81 1058 801.32 780 820 217163 217163 0.00%
crit 22.64% 79.34 46 118 1600.56 162 2115 1600.59 1493 1693 126985 126985 0.00%

Action Details: Soulforge Embers

  • id:336746
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:336746
  • name:Soulforge Embers
  • school:fire
  • tooltip:Burning for $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc336745=Launching a Flare into your Tar Trap causes up to {$s1=5} enemies inside of the Tar Trap to burn for $336746o Fire damage over {$331269d=12 seconds}.}
Steady Shot 287 3.6% 54.9 5.46sec 1576 1163 Direct 55.8 1265 2529 1550 22.6%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.91 55.82 0.00 0.00 1.3557 0.0000 86541.72 123616.19 29.99% 1162.55 1162.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.38% 43.19 27 61 1264.54 1219 1605 1264.25 1230 1300 54619 78018 29.99%
crit 22.62% 12.62 1 24 2528.67 2439 3210 2528.20 2439 2840 31923 45599 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.80
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [Q]:38.32
Wild Spirits 28 (767) 0.3% (9.5%) 3.0 120.75sec 76986 69797 Direct 8.9 (128.0) 751 1501 922 22.8% (22.5%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 8.90 0.00 0.00 1.1031 0.0000 8210.23 8210.23 0.00% 69796.62 69796.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.23% 6.88 2 9 751.40 726 823 751.32 726 799 5166 5166 0.00%
crit 22.77% 2.03 0 7 1501.43 1452 1645 1338.14 0 1645 3044 3044 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [J]:2.98
    Wild Spirits (_proc) 740 9.1% 39.7 6.46sec 5568 0 Direct 119.1 1515 3030 1856 22.5%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.69 119.08 0.00 0.00 0.0000 0.0000 221001.86 221001.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.50% 92.28 59 115 1515.06 1355 1699 1515.58 1486 1563 139816 139816 0.00%
crit 22.50% 26.80 10 41 3029.58 2711 3398 3030.11 2902 3165 81186 81186 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
soulforge_embers
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:soulforge_embers
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.71sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.60sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 0.00 0.00 0.00 0.9792 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.64
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Flare 14.4 21.43sec

Stats Details: Flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.43 0.00 0.00 0.00 1.1537 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flare

  • id:1543
  • school:arcane
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1543
  • name:Flare
  • school:arcane
  • tooltip:
  • description:Exposes all hidden and invisible enemies within the targeted area for $m1 sec.

Action Priority List

    trickshots
    [I]:14.42
  • if_expr:tar_trap.up&runeforge.soulforge_embers
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:soulforge_embers
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:soulforge_embers
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 308.81sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Tar Trap 7.5 43.03sec

Stats Details: Tar Trap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.52 0.00 0.00 0.00 1.0330 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tar Trap

  • id:187698
  • school:physical
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:187698
  • name:Tar Trap
  • school:physical
  • tooltip:
  • description:Hurls a tar trap to the target location that creates a {$187699s1=8} yd radius pool of tar around itself for {$13810d=30 seconds} when the first enemy approaches. All enemies have {$135299s1=50}% reduced movement speed while in the area of effect. Trap will exist for {$13809d=60 seconds}.

Action Priority List

    trickshots
    [H]:6.52
  • if_expr:runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
Trueshot 3.0 120.72sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [K]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.7sec 120.7sec 14.7sec 14.60% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 123.8s
  • trigger_min/max:120.0s / 123.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.60%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.6sec 8.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • double_tap_1:8.73%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.9 0.2 30.7sec 29.8sec 2.1sec 6.24% 18.68% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 252.5s
  • trigger_min/max:1.8s / 252.5s
  • trigger_pct:8.04%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • lock_and_load_1:6.24%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 308.7sec 308.7sec 23.2sec 11.11% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 331.5s
  • trigger_min/max:300.0s / 331.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.11%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 38.5 8.1 7.8sec 6.4sec 3.2sec 41.43% 85.35% 4.1 (4.1) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 43.6s
  • trigger_min/max:0.9s / 15.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.3s

Stack Uptimes

  • precise_shots_1:34.83%
  • precise_shots_2:6.61%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 9.0 12.2 35.2sec 14.4sec 29.5sec 87.86% 0.00% 12.2 (12.2) 8.1

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 156.4s
  • trigger_min/max:4.0s / 48.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 155.6s

Stack Uptimes

  • steady_focus_1:87.86%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 63.1 13.4 4.7sec 3.9sec 4.1sec 85.94% 100.00% 13.4 (13.4) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 13.5s
  • trigger_min/max:0.9s / 12.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • trick_shots_1:85.94%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.7sec 120.7sec 19.1sec 18.97% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 123.8s
  • trigger_min/max:120.0s / 123.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • trueshot_1:18.97%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.6sec 17.45% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 123.7s
  • trigger_min/max:120.0s / 123.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.45%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.4 1.0 7.0 73.6s 46.2s 291.3s
double_tap_rapid_fire 1.1 0.0 4.0 108.5s 56.0s 248.0s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 1.26% 0.92% 3.03% 1.0s 0.0s 3.7s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Tar Trap17.88716.16522.925116.57784.903151.253
Double Tap0.7270.0012.7082.8020.1837.354
Aimed Shot1.4850.0018.37716.0464.64033.715
Kill Shot5.0330.00234.90514.7080.01734.905
Flare1.6530.0015.88219.13211.20430.550
Wild Spirits0.8330.0023.6761.3840.0004.926
Trueshot0.8000.0013.8051.3610.0005.236
Rapid Fire3.6750.00124.58649.15120.54384.333

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
soulforge_embers
steady_shot Focus 55.91 539.03 19.04% 9.64 20.04 3.59%
rapid_fire Focus 118.38 117.79 4.16% 1.00 0.58 0.49%
focus_regen Focus 612.71 1932.27 68.27% 3.15 30.06 1.53%
Trueshot Focus 182.85 241.37 8.53% 1.32 2.20 0.90%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.41 9.61 52.9 38.2 0.1 100.0
Usage Type Count Total Avg RPE APR
soulforge_embers
aimed_shot Focus 46.5 1320.7 28.4 28.4 599.2
kill_shot Focus 4.2 41.7 10.0 10.0 539.1
multishot Focus 76.5 1529.8 20.0 20.0 302.7

Statistics & Data Analysis

Fight Length
soulforge_embers Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
soulforge_embers Damage Per Second
Count 1323
Mean 8068.88
Minimum 7471.94
Maximum 8967.28
Spread ( max - min ) 1495.34
Range [ ( max - min ) / 2 * 100% ] 9.27%
Standard Deviation 230.6428
5th Percentile 7714.74
95th Percentile 8460.97
( 95th Percentile - 5th Percentile ) 746.23
Mean Distribution
Standard Deviation 6.3410
95.00% Confidence Interval ( 8056.45 - 8081.31 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3139
0.1 Scale Factor Error with Delta=300 455
0.05 Scale Factor Error with Delta=300 1817
0.01 Scale Factor Error with Delta=300 45412
Priority Target DPS
soulforge_embers Priority Target Damage Per Second
Count 1323
Mean 3914.38
Minimum 3574.71
Maximum 4369.03
Spread ( max - min ) 794.32
Range [ ( max - min ) / 2 * 100% ] 10.15%
Standard Deviation 127.8723
5th Percentile 3713.76
95th Percentile 4132.72
( 95th Percentile - 5th Percentile ) 418.96
Mean Distribution
Standard Deviation 3.5156
95.00% Confidence Interval ( 3907.49 - 3921.27 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4100
0.1 Scale Factor Error with Delta=300 140
0.05 Scale Factor Error with Delta=300 559
0.01 Scale Factor Error with Delta=300 13959
DPS(e)
soulforge_embers Damage Per Second (Effective)
Count 1323
Mean 8068.88
Minimum 7471.94
Maximum 8967.28
Spread ( max - min ) 1495.34
Range [ ( max - min ) / 2 * 100% ] 9.27%
Damage
soulforge_embers Damage
Count 1323
Mean 2423427.56
Minimum 1859314.24
Maximum 2909430.52
Spread ( max - min ) 1050116.28
Range [ ( max - min ) / 2 * 100% ] 21.67%
DTPS
soulforge_embers Damage Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
soulforge_embers Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
soulforge_embers Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
soulforge_embers Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
soulforge_embers Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
soulforge_embers Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
soulforge_embersTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
soulforge_embers Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.76 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.80 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.64 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
H 6.52 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
I 14.42 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
J 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
K 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
L 46.74 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
M 15.81 rapid_fire,if=buff.trick_shots.remains>=execute_time
N 71.59 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
O 4.17 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
P 4.90 multishot,if=focus>cost+action.aimed_shot.cost
Q 38.32 steady_shot

Sample Sequence

01245789FJIKDENLNLNMNLNLNMNLQFNLNILQNMNQFLNNLNQQQNLHNIQMNGLNQFLNNLNQIQFMNLNQLNQFPLHNIL9NMNQFLNQPQLNIQFGMNLNQNJKDLNQFHLINLNLQNMNLNQFQNLINMNQFLNQNLNQFGHNILNM9NQFLNQQNLNIQQMNLNQQPLNQQHPILNMNQFPLNGLNQQINLJKDNLQNMNLNQFHLINLNMNLQF9NOQNLNIQFLNMNLGNLNOQFHLINQMNLENOQFNLNQIOQMNLNQFNL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask soulforge_embers 100.0/100: 100% focus
Pre precombat 1 augmentation soulforge_embers 100.0/100: 100% focus
Pre precombat 2 food soulforge_embers 100.0/100: 100% focus
Pre precombat 4 tar_trap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.484 trickshots J wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.399 trickshots I flare Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:03.315 trickshots K trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, wild_spirits
0:03.315 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot, wild_spirits
0:03.315 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, wild_spirits
0:03.315 trickshots N multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:04.230 trickshots L aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:05.146 trickshots N multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.061 trickshots L aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.977 trickshots N multishot Fluffy_Pillow 34.5/100: 35% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:07.892 trickshots M rapid_fire Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:09.307 trickshots N multishot Fluffy_Pillow 54.3/100: 54% focus bloodlust, blood_fury, lock_and_load, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:10.224 trickshots L aimed_shot Fluffy_Pillow 45.6/100: 46% focus bloodlust, blood_fury, lock_and_load, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:11.139 trickshots N multishot Fluffy_Pillow 56.9/100: 57% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:12.055 trickshots L aimed_shot Fluffy_Pillow 48.2/100: 48% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.972 trickshots N multishot Fluffy_Pillow 24.5/100: 25% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:13.888 trickshots M rapid_fire Fluffy_Pillow 15.8/100: 16% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:15.402 trickshots N multishot Fluffy_Pillow 46.5/100: 47% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:16.316 trickshots L aimed_shot Fluffy_Pillow 37.8/100: 38% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:17.231 trickshots Q steady_shot Fluffy_Pillow 13.5/100: 13% focus bloodlust, blood_fury, precise_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:18.375 trickshots F steady_shot Fluffy_Pillow 41.7/100: 42% focus bloodlust, precise_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:19.515 trickshots N multishot Fluffy_Pillow 69.8/100: 70% focus bloodlust, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:20.430 trickshots L aimed_shot Fluffy_Pillow 61.1/100: 61% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:21.346 trickshots N multishot Fluffy_Pillow 37.4/100: 37% focus bloodlust, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:22.262 trickshots I flare Fluffy_Pillow 28.7/100: 29% focus bloodlust, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:23.314 trickshots L aimed_shot Fluffy_Pillow 40.3/100: 40% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:24.837 trickshots Q steady_shot Fluffy_Pillow 17.8/100: 18% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:25.904 trickshots N multishot Fluffy_Pillow 36.6/100: 37% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:26.819 trickshots M rapid_fire Fluffy_Pillow 24.1/100: 24% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:28.309 trickshots N multishot Fluffy_Pillow 43.4/100: 43% focus bloodlust, steady_focus, potion_of_spectral_agility
0:29.225 trickshots Q steady_shot Fluffy_Pillow 30.9/100: 31% focus bloodlust, steady_focus, trick_shots
0:30.292 trickshots F steady_shot Fluffy_Pillow 49.7/100: 50% focus bloodlust, steady_focus, trick_shots
0:31.360 trickshots L aimed_shot Fluffy_Pillow 68.5/100: 68% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:32.276 trickshots N multishot Fluffy_Pillow 76.0/100: 76% focus bloodlust, precise_shots(2), steady_focus
0:33.191 trickshots N multishot Fluffy_Pillow 63.5/100: 64% focus bloodlust, precise_shots, steady_focus, trick_shots
0:34.105 trickshots L aimed_shot Fluffy_Pillow 51.1/100: 51% focus bloodlust, steady_focus, trick_shots
0:35.630 trickshots N multishot Fluffy_Pillow 28.6/100: 29% focus bloodlust, precise_shots(2), steady_focus
0:36.545 trickshots Q steady_shot Fluffy_Pillow 16.1/100: 16% focus bloodlust, precise_shots, steady_focus, trick_shots
0:37.611 trickshots Q steady_shot Fluffy_Pillow 34.9/100: 35% focus bloodlust, precise_shots, steady_focus, trick_shots
0:38.679 trickshots Q steady_shot Fluffy_Pillow 53.7/100: 54% focus bloodlust, precise_shots, steady_focus, trick_shots
0:39.747 trickshots N multishot Fluffy_Pillow 72.5/100: 72% focus bloodlust, precise_shots, steady_focus, trick_shots
0:40.663 trickshots L aimed_shot Fluffy_Pillow 60.0/100: 60% focus bloodlust, steady_focus, trick_shots
0:42.189 trickshots H tar_trap Fluffy_Pillow 35.3/100: 35% focus precise_shots(2), steady_focus
0:43.380 trickshots N multishot Fluffy_Pillow 42.9/100: 43% focus precise_shots(2), steady_focus
0:44.568 trickshots I flare Fluffy_Pillow 30.4/100: 30% focus precise_shots, steady_focus, trick_shots
0:45.756 trickshots Q steady_shot Fluffy_Pillow 37.9/100: 38% focus precise_shots, steady_focus, trick_shots
0:47.143 trickshots M rapid_fire Fluffy_Pillow 56.7/100: 57% focus precise_shots, steady_focus, trick_shots
0:49.000 trickshots N multishot Fluffy_Pillow 75.4/100: 75% focus precise_shots, steady_focus
0:50.187 trickshots G double_tap Fluffy_Pillow 62.9/100: 63% focus steady_focus, trick_shots
0:51.374 trickshots L aimed_shot Fluffy_Pillow 70.5/100: 70% focus double_tap, steady_focus, trick_shots
0:53.352 trickshots N multishot Fluffy_Pillow 48.0/100: 48% focus precise_shots(2), steady_focus
0:54.538 trickshots Q steady_shot Fluffy_Pillow 35.1/100: 35% focus precise_shots, trick_shots
0:56.022 trickshots F steady_shot Fluffy_Pillow 53.9/100: 54% focus precise_shots, trick_shots
0:57.506 trickshots L aimed_shot Fluffy_Pillow 72.7/100: 73% focus lock_and_load, precise_shots, steady_focus, trick_shots
0:58.695 trickshots N multishot Fluffy_Pillow 80.2/100: 80% focus precise_shots(2), steady_focus
0:59.883 trickshots N multishot Fluffy_Pillow 67.7/100: 68% focus precise_shots, steady_focus, trick_shots
1:01.070 trickshots L aimed_shot Fluffy_Pillow 55.2/100: 55% focus steady_focus, trick_shots
1:03.050 trickshots N multishot Fluffy_Pillow 32.8/100: 33% focus precise_shots(2), steady_focus
1:04.239 trickshots Q steady_shot Fluffy_Pillow 20.3/100: 20% focus precise_shots, steady_focus, trick_shots
1:05.626 trickshots I flare Fluffy_Pillow 39.1/100: 39% focus precise_shots, steady_focus, trick_shots
1:06.814 trickshots Q steady_shot Fluffy_Pillow 46.6/100: 47% focus precise_shots, steady_focus, trick_shots
1:08.201 trickshots F steady_shot Fluffy_Pillow 65.4/100: 65% focus precise_shots, steady_focus, trick_shots
1:09.586 trickshots M rapid_fire Fluffy_Pillow 84.1/100: 84% focus precise_shots, steady_focus, trick_shots
1:11.364 trickshots N multishot Fluffy_Pillow 100.0/100: 100% focus precise_shots, steady_focus
1:12.553 trickshots L aimed_shot Fluffy_Pillow 87.5/100: 88% focus steady_focus, trick_shots
1:14.532 trickshots N multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus
1:15.721 trickshots Q steady_shot Fluffy_Pillow 52.6/100: 53% focus steady_focus, trick_shots
1:17.107 trickshots L aimed_shot Fluffy_Pillow 71.3/100: 71% focus steady_focus, trick_shots
1:19.086 trickshots N multishot Fluffy_Pillow 48.9/100: 49% focus precise_shots, steady_focus
1:20.275 trickshots Q steady_shot Fluffy_Pillow 36.4/100: 36% focus steady_focus, trick_shots
1:21.662 trickshots F steady_shot Fluffy_Pillow 55.2/100: 55% focus steady_focus, trick_shots
1:23.049 trickshots P multishot Fluffy_Pillow 73.9/100: 74% focus steady_focus, trick_shots
1:24.238 trickshots L aimed_shot Fluffy_Pillow 61.5/100: 61% focus lock_and_load, steady_focus, trick_shots
1:25.427 trickshots H tar_trap Fluffy_Pillow 69.0/100: 69% focus precise_shots, steady_focus
1:26.615 trickshots N multishot Fluffy_Pillow 76.5/100: 77% focus precise_shots, steady_focus
1:27.803 trickshots I flare Fluffy_Pillow 64.0/100: 64% focus steady_focus, trick_shots
1:28.991 trickshots L aimed_shot Fluffy_Pillow 71.5/100: 72% focus steady_focus, trick_shots
1:30.968 default 9 use_items Fluffy_Pillow 49.1/100: 49% focus precise_shots(2), steady_focus
1:30.968 trickshots N multishot Fluffy_Pillow 49.1/100: 49% focus precise_shots(2), steady_focus
1:32.157 trickshots M rapid_fire Fluffy_Pillow 36.6/100: 37% focus precise_shots, steady_focus, trick_shots
1:33.880 trickshots N multishot Fluffy_Pillow 54.5/100: 54% focus precise_shots, steady_focus
1:35.067 trickshots Q steady_shot Fluffy_Pillow 42.0/100: 42% focus steady_focus, trick_shots
1:36.452 trickshots F steady_shot Fluffy_Pillow 60.8/100: 61% focus steady_focus, trick_shots
1:37.838 trickshots L aimed_shot Fluffy_Pillow 79.5/100: 80% focus steady_focus, trick_shots
1:39.816 trickshots N multishot Fluffy_Pillow 57.1/100: 57% focus precise_shots, steady_focus
1:41.006 trickshots Q steady_shot Fluffy_Pillow 44.6/100: 45% focus steady_focus, trick_shots
1:42.392 trickshots P multishot Fluffy_Pillow 63.4/100: 63% focus steady_focus, trick_shots
1:43.582 trickshots Q steady_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus, trick_shots
1:44.969 trickshots L aimed_shot Fluffy_Pillow 69.7/100: 70% focus steady_focus, trick_shots
1:46.948 trickshots N multishot Fluffy_Pillow 47.2/100: 47% focus precise_shots, steady_focus
1:48.138 trickshots I flare Fluffy_Pillow 34.7/100: 35% focus steady_focus, trick_shots
1:49.327 trickshots Q steady_shot Fluffy_Pillow 42.3/100: 42% focus steady_focus, trick_shots
1:50.712 trickshots F steady_shot Fluffy_Pillow 61.0/100: 61% focus steady_focus, trick_shots
1:52.099 trickshots G double_tap Fluffy_Pillow 79.8/100: 80% focus steady_focus, trick_shots
1:53.287 trickshots M rapid_fire Fluffy_Pillow 87.3/100: 87% focus double_tap, steady_focus, trick_shots
1:55.281 trickshots N multishot Fluffy_Pillow 100.0/100: 100% focus steady_focus
1:56.470 trickshots L aimed_shot Fluffy_Pillow 87.5/100: 88% focus steady_focus, trick_shots
1:58.448 trickshots N multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots(2), steady_focus
1:59.635 trickshots Q steady_shot Fluffy_Pillow 52.5/100: 53% focus precise_shots, steady_focus, trick_shots
2:01.023 trickshots N multishot Fluffy_Pillow 71.3/100: 71% focus precise_shots, steady_focus, trick_shots
2:02.211 trickshots J wild_spirits Fluffy_Pillow 58.8/100: 59% focus steady_focus, trick_shots
2:03.398 trickshots K trueshot Fluffy_Pillow 66.4/100: 66% focus steady_focus, trick_shots
2:03.398 cds D blood_fury Fluffy_Pillow 66.4/100: 66% focus steady_focus, trick_shots, trueshot
2:03.398 trickshots L aimed_shot Fluffy_Pillow 66.4/100: 66% focus blood_fury, steady_focus, trick_shots, trueshot
2:04.729 trickshots N multishot Fluffy_Pillow 44.0/100: 44% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:05.918 trickshots Q steady_shot Fluffy_Pillow 35.3/100: 35% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:07.303 trickshots F steady_shot Fluffy_Pillow 63.3/100: 63% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits
2:08.787 trickshots H tar_trap Fluffy_Pillow 91.5/100: 91% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:09.974 trickshots L aimed_shot Fluffy_Pillow 100.0/100: 100% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:11.162 trickshots I flare Fluffy_Pillow 66.9/100: 67% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:12.351 trickshots N multishot Fluffy_Pillow 78.2/100: 78% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:13.539 trickshots L aimed_shot Fluffy_Pillow 69.5/100: 69% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:14.727 trickshots N multishot Fluffy_Pillow 45.8/100: 46% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:15.913 trickshots L aimed_shot Fluffy_Pillow 37.0/100: 37% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:17.101 trickshots Q steady_shot Fluffy_Pillow 13.3/100: 13% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:18.487 trickshots N multishot Fluffy_Pillow 41.5/100: 41% focus precise_shots(2), steady_focus, trueshot, wild_spirits
2:19.675 trickshots M rapid_fire Fluffy_Pillow 32.7/100: 33% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:21.469 trickshots N multishot Fluffy_Pillow 60.8/100: 61% focus precise_shots, steady_focus, trueshot, wild_spirits
2:22.657 trickshots L aimed_shot Fluffy_Pillow 52.0/100: 52% focus steady_focus, trick_shots, trueshot
2:23.845 trickshots N multishot Fluffy_Pillow 25.8/100: 26% focus precise_shots(2)
2:25.118 trickshots Q steady_shot Fluffy_Pillow 13.3/100: 13% focus precise_shots, trick_shots
2:26.601 trickshots F steady_shot Fluffy_Pillow 32.1/100: 32% focus precise_shots, trick_shots
2:28.086 trickshots Q steady_shot Fluffy_Pillow 50.9/100: 51% focus precise_shots, steady_focus, trick_shots
2:29.472 trickshots N multishot Fluffy_Pillow 69.6/100: 70% focus precise_shots, steady_focus, trick_shots
2:30.661 trickshots L aimed_shot Fluffy_Pillow 57.2/100: 57% focus steady_focus, trick_shots
2:32.640 trickshots I flare Fluffy_Pillow 34.7/100: 35% focus precise_shots(2), steady_focus
2:33.828 trickshots N multishot Fluffy_Pillow 42.2/100: 42% focus precise_shots(2), steady_focus
2:35.017 trickshots M rapid_fire Fluffy_Pillow 29.7/100: 30% focus precise_shots, steady_focus, trick_shots
2:36.694 trickshots N multishot Fluffy_Pillow 47.3/100: 47% focus precise_shots, steady_focus
2:37.883 trickshots Q steady_shot Fluffy_Pillow 34.9/100: 35% focus steady_focus, trick_shots
2:39.270 trickshots F steady_shot Fluffy_Pillow 53.6/100: 54% focus steady_focus, trick_shots
2:40.657 trickshots L aimed_shot Fluffy_Pillow 72.4/100: 72% focus steady_focus, trick_shots
2:42.636 trickshots N multishot Fluffy_Pillow 49.9/100: 50% focus precise_shots(2), steady_focus
2:43.824 trickshots Q steady_shot Fluffy_Pillow 37.5/100: 37% focus precise_shots, steady_focus, trick_shots
2:45.211 trickshots N multishot Fluffy_Pillow 56.2/100: 56% focus precise_shots, steady_focus, trick_shots
2:46.400 trickshots L aimed_shot Fluffy_Pillow 43.8/100: 44% focus steady_focus, trick_shots
2:48.379 trickshots N multishot Fluffy_Pillow 21.3/100: 21% focus precise_shots(2), steady_focus
2:49.567 trickshots Q steady_shot Fluffy_Pillow 8.8/100: 9% focus precise_shots, steady_focus, trick_shots
2:50.953 trickshots F steady_shot Fluffy_Pillow 27.6/100: 28% focus precise_shots, steady_focus, trick_shots
2:52.339 trickshots G double_tap Fluffy_Pillow 46.4/100: 46% focus precise_shots, steady_focus, trick_shots
2:53.528 trickshots H tar_trap Fluffy_Pillow 53.9/100: 54% focus double_tap, precise_shots, steady_focus, trick_shots
2:54.716 trickshots N multishot Fluffy_Pillow 61.4/100: 61% focus double_tap, precise_shots, steady_focus, trick_shots
2:55.904 trickshots I flare Fluffy_Pillow 48.9/100: 49% focus double_tap, steady_focus, trick_shots
2:57.092 trickshots L aimed_shot Fluffy_Pillow 56.4/100: 56% focus double_tap, steady_focus, trick_shots
2:59.071 trickshots N multishot Fluffy_Pillow 34.0/100: 34% focus precise_shots(2), steady_focus
3:00.260 trickshots M rapid_fire Fluffy_Pillow 21.5/100: 21% focus precise_shots, steady_focus, trick_shots
3:01.993 default 9 use_items Fluffy_Pillow 39.5/100: 39% focus precise_shots, steady_focus
3:01.993 trickshots N multishot Fluffy_Pillow 39.5/100: 39% focus precise_shots, steady_focus
3:03.181 trickshots Q steady_shot Fluffy_Pillow 27.0/100: 27% focus steady_focus, trick_shots
3:04.566 trickshots F steady_shot Fluffy_Pillow 45.7/100: 46% focus steady_focus, trick_shots
3:05.953 trickshots L aimed_shot Fluffy_Pillow 64.5/100: 65% focus steady_focus, trick_shots
3:07.931 trickshots N multishot Fluffy_Pillow 42.0/100: 42% focus precise_shots(2), steady_focus
3:09.120 trickshots Q steady_shot Fluffy_Pillow 29.6/100: 30% focus precise_shots, steady_focus, trick_shots
3:10.506 trickshots Q steady_shot Fluffy_Pillow 48.3/100: 48% focus precise_shots, steady_focus, trick_shots
3:11.891 trickshots N multishot Fluffy_Pillow 67.1/100: 67% focus precise_shots, steady_focus, trick_shots
3:13.080 trickshots L aimed_shot Fluffy_Pillow 54.6/100: 55% focus steady_focus, trick_shots
3:15.058 trickshots N multishot Fluffy_Pillow 32.2/100: 32% focus precise_shots(2), steady_focus
3:16.246 trickshots I flare Fluffy_Pillow 19.7/100: 20% focus precise_shots, steady_focus, trick_shots
3:17.434 trickshots Q steady_shot Fluffy_Pillow 27.2/100: 27% focus precise_shots, steady_focus, trick_shots
3:18.819 trickshots Q steady_shot Fluffy_Pillow 46.0/100: 46% focus precise_shots, steady_focus, trick_shots
3:20.203 trickshots M rapid_fire Fluffy_Pillow 64.7/100: 65% focus precise_shots, steady_focus, trick_shots
3:22.005 trickshots N multishot Fluffy_Pillow 83.1/100: 83% focus precise_shots, steady_focus
3:23.192 trickshots L aimed_shot Fluffy_Pillow 70.6/100: 71% focus steady_focus, trick_shots
3:25.170 trickshots N multishot Fluffy_Pillow 48.2/100: 48% focus precise_shots, steady_focus
3:26.357 trickshots Q steady_shot Fluffy_Pillow 35.7/100: 36% focus steady_focus, trick_shots
3:27.743 trickshots Q steady_shot Fluffy_Pillow 54.4/100: 54% focus steady_focus, trick_shots
3:29.129 trickshots P multishot Fluffy_Pillow 73.2/100: 73% focus steady_focus, trick_shots
3:30.318 trickshots L aimed_shot Fluffy_Pillow 60.7/100: 61% focus steady_focus, trick_shots
3:32.297 trickshots N multishot Fluffy_Pillow 38.3/100: 38% focus precise_shots, steady_focus
3:33.487 trickshots Q steady_shot Fluffy_Pillow 25.8/100: 26% focus steady_focus, trick_shots
3:34.874 trickshots Q steady_shot Fluffy_Pillow 44.6/100: 45% focus steady_focus, trick_shots
3:36.260 trickshots H tar_trap Fluffy_Pillow 63.3/100: 63% focus steady_focus, trick_shots
3:37.448 trickshots P multishot Fluffy_Pillow 70.9/100: 71% focus steady_focus, trick_shots
3:38.637 trickshots I flare Fluffy_Pillow 58.4/100: 58% focus steady_focus, trick_shots
3:39.825 trickshots L aimed_shot Fluffy_Pillow 65.9/100: 66% focus steady_focus, trick_shots
3:41.802 trickshots N multishot Fluffy_Pillow 43.4/100: 43% focus precise_shots(2), steady_focus
3:42.990 trickshots M rapid_fire Fluffy_Pillow 30.9/100: 31% focus precise_shots, steady_focus, trick_shots
3:44.859 trickshots N multishot Fluffy_Pillow 49.8/100: 50% focus precise_shots, steady_focus
3:46.047 trickshots Q steady_shot Fluffy_Pillow 37.3/100: 37% focus steady_focus, trick_shots
3:47.434 trickshots F steady_shot Fluffy_Pillow 56.1/100: 56% focus steady_focus, trick_shots
3:48.820 trickshots P multishot Fluffy_Pillow 74.8/100: 75% focus steady_focus, trick_shots
3:50.008 trickshots L aimed_shot Fluffy_Pillow 62.4/100: 62% focus lock_and_load, steady_focus, trick_shots
3:51.197 trickshots N multishot Fluffy_Pillow 69.9/100: 70% focus precise_shots, steady_focus
3:52.385 trickshots G double_tap Fluffy_Pillow 57.4/100: 57% focus steady_focus, trick_shots
3:53.573 trickshots L aimed_shot Fluffy_Pillow 64.9/100: 65% focus double_tap, steady_focus, trick_shots
3:55.550 trickshots N multishot Fluffy_Pillow 42.4/100: 42% focus precise_shots(2), steady_focus
3:56.739 trickshots Q steady_shot Fluffy_Pillow 30.0/100: 30% focus precise_shots, steady_focus, trick_shots
3:58.125 trickshots Q steady_shot Fluffy_Pillow 48.7/100: 49% focus precise_shots, steady_focus, trick_shots
3:59.513 trickshots I flare Fluffy_Pillow 67.5/100: 68% focus precise_shots, steady_focus, trick_shots
4:00.702 trickshots N multishot Fluffy_Pillow 75.0/100: 75% focus precise_shots, steady_focus, trick_shots
4:01.891 trickshots L aimed_shot Fluffy_Pillow 62.6/100: 63% focus steady_focus, trick_shots
4:03.869 trickshots J wild_spirits Fluffy_Pillow 40.1/100: 40% focus precise_shots, steady_focus
4:05.058 trickshots K trueshot Fluffy_Pillow 47.6/100: 48% focus precise_shots, steady_focus
4:05.058 cds D blood_fury Fluffy_Pillow 47.6/100: 48% focus precise_shots, steady_focus, trueshot
4:05.058 trickshots N multishot Fluffy_Pillow 47.6/100: 48% focus blood_fury, precise_shots, steady_focus, trueshot
4:06.246 trickshots L aimed_shot Fluffy_Pillow 38.9/100: 39% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:07.448 trickshots Q steady_shot Fluffy_Pillow 15.3/100: 15% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:08.835 trickshots N multishot Fluffy_Pillow 43.5/100: 43% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:10.023 trickshots M rapid_fire Fluffy_Pillow 34.8/100: 35% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:11.860 trickshots N multishot Fluffy_Pillow 63.2/100: 63% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:13.049 trickshots L aimed_shot Fluffy_Pillow 54.5/100: 54% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:14.238 trickshots N multishot Fluffy_Pillow 30.8/100: 31% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:15.426 trickshots Q steady_shot Fluffy_Pillow 21.5/100: 21% focus blood_fury, trick_shots, trueshot, wild_spirits
4:16.909 trickshots F steady_shot Fluffy_Pillow 49.6/100: 50% focus blood_fury, trick_shots, trueshot, wild_spirits
4:18.392 trickshots H tar_trap Fluffy_Pillow 77.8/100: 78% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:19.580 trickshots L aimed_shot Fluffy_Pillow 89.1/100: 89% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:20.768 trickshots I flare Fluffy_Pillow 65.4/100: 65% focus precise_shots, steady_focus, trueshot, wild_spirits
4:21.957 trickshots N multishot Fluffy_Pillow 76.6/100: 77% focus precise_shots, steady_focus, trueshot, wild_spirits
4:23.146 trickshots L aimed_shot Fluffy_Pillow 67.9/100: 68% focus steady_focus, trick_shots, trueshot, wild_spirits
4:24.335 trickshots N multishot Fluffy_Pillow 44.2/100: 44% focus precise_shots(2), steady_focus, trueshot
4:25.523 trickshots M rapid_fire Fluffy_Pillow 32.9/100: 33% focus precise_shots, steady_focus, trick_shots
4:27.266 trickshots N multishot Fluffy_Pillow 50.9/100: 51% focus precise_shots, steady_focus
4:28.453 trickshots L aimed_shot Fluffy_Pillow 38.5/100: 38% focus steady_focus, trick_shots
4:30.432 trickshots Q steady_shot Fluffy_Pillow 16.0/100: 16% focus precise_shots(2), steady_focus
4:31.818 trickshots F steady_shot Fluffy_Pillow 34.8/100: 35% focus precise_shots(2), steady_focus
4:33.205 default 9 use_items Fluffy_Pillow 53.5/100: 54% focus precise_shots(2), steady_focus
4:33.205 trickshots N multishot Fluffy_Pillow 53.5/100: 54% focus precise_shots(2), steady_focus
4:34.394 trickshots O kill_shot Fluffy_Pillow 41.1/100: 41% focus precise_shots, steady_focus, trick_shots
4:35.584 trickshots Q steady_shot Fluffy_Pillow 38.6/100: 39% focus precise_shots, steady_focus, trick_shots
4:36.969 trickshots N multishot Fluffy_Pillow 57.4/100: 57% focus precise_shots, steady_focus, trick_shots
4:38.156 trickshots L aimed_shot Fluffy_Pillow 44.9/100: 45% focus steady_focus, trick_shots
4:40.134 trickshots N multishot Fluffy_Pillow 22.4/100: 22% focus precise_shots(2), steady_focus
4:41.323 trickshots I flare Fluffy_Pillow 9.9/100: 10% focus precise_shots, steady_focus, trick_shots
4:42.512 trickshots Q steady_shot Fluffy_Pillow 17.4/100: 17% focus precise_shots, steady_focus, trick_shots
4:43.899 trickshots F steady_shot Fluffy_Pillow 36.2/100: 36% focus precise_shots, steady_focus, trick_shots
4:45.287 trickshots L aimed_shot Fluffy_Pillow 55.0/100: 55% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:46.474 trickshots N multishot Fluffy_Pillow 62.5/100: 63% focus precise_shots(2), steady_focus
4:47.662 trickshots M rapid_fire Fluffy_Pillow 50.0/100: 50% focus precise_shots, steady_focus, trick_shots
4:49.559 trickshots N multishot Fluffy_Pillow 69.0/100: 69% focus precise_shots, steady_focus
4:50.747 trickshots L aimed_shot Fluffy_Pillow 56.6/100: 57% focus steady_focus, trick_shots
4:52.725 trickshots G double_tap Fluffy_Pillow 34.1/100: 34% focus precise_shots(2), steady_focus
4:53.913 trickshots N multishot Fluffy_Pillow 41.6/100: 42% focus double_tap, precise_shots(2), steady_focus
4:55.102 trickshots L aimed_shot Fluffy_Pillow 29.1/100: 29% focus double_tap, lock_and_load, precise_shots, steady_focus, trick_shots
4:56.291 trickshots N multishot Fluffy_Pillow 36.7/100: 37% focus precise_shots(2), steady_focus
4:57.478 trickshots O kill_shot Fluffy_Pillow 24.2/100: 24% focus precise_shots, steady_focus, trick_shots
4:58.668 trickshots Q steady_shot Fluffy_Pillow 21.7/100: 22% focus precise_shots, steady_focus, trick_shots
5:00.054 trickshots F steady_shot Fluffy_Pillow 40.5/100: 40% focus precise_shots, steady_focus, trick_shots
5:01.443 trickshots H tar_trap Fluffy_Pillow 58.8/100: 59% focus precise_shots, steady_focus, trick_shots
5:02.631 trickshots L aimed_shot Fluffy_Pillow 66.3/100: 66% focus precise_shots, steady_focus, trick_shots
5:04.610 trickshots I flare Fluffy_Pillow 43.8/100: 44% focus precise_shots(2), steady_focus
5:05.800 trickshots N multishot Fluffy_Pillow 51.4/100: 51% focus precise_shots(2), steady_focus
5:06.989 trickshots Q steady_shot Fluffy_Pillow 38.9/100: 39% focus precise_shots, steady_focus, trick_shots
5:08.377 trickshots M rapid_fire Fluffy_Pillow 57.7/100: 58% focus precise_shots, steady_focus, trick_shots
5:10.252 trickshots N multishot Fluffy_Pillow 76.5/100: 77% focus precise_shots, steady_focus
5:11.441 trickshots L aimed_shot Fluffy_Pillow 64.1/100: 64% focus steady_focus, trick_shots
5:13.419 cds E potion Fluffy_Pillow 41.6/100: 42% focus precise_shots(2), steady_focus
5:13.419 trickshots N multishot Fluffy_Pillow 41.6/100: 42% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:14.610 trickshots O kill_shot Fluffy_Pillow 29.1/100: 29% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:15.799 trickshots Q steady_shot Fluffy_Pillow 26.6/100: 27% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:17.185 trickshots F steady_shot Fluffy_Pillow 45.1/100: 45% focus precise_shots, trick_shots, potion_of_spectral_agility
5:18.668 trickshots N multishot Fluffy_Pillow 63.9/100: 64% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:19.856 trickshots L aimed_shot Fluffy_Pillow 51.4/100: 51% focus steady_focus, trick_shots, potion_of_spectral_agility
5:21.836 trickshots N multishot Fluffy_Pillow 28.9/100: 29% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:23.025 trickshots Q steady_shot Fluffy_Pillow 16.5/100: 16% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:24.412 trickshots I flare Fluffy_Pillow 35.2/100: 35% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:25.799 trickshots O kill_shot Fluffy_Pillow 44.0/100: 44% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:26.987 trickshots Q steady_shot Fluffy_Pillow 41.5/100: 42% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:28.372 trickshots M rapid_fire Fluffy_Pillow 60.3/100: 60% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:30.179 trickshots N multishot Fluffy_Pillow 78.7/100: 79% focus precise_shots, steady_focus, potion_of_spectral_agility
5:31.369 trickshots L aimed_shot Fluffy_Pillow 66.3/100: 66% focus steady_focus, trick_shots, potion_of_spectral_agility
5:33.347 trickshots N multishot Fluffy_Pillow 43.8/100: 44% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:34.536 trickshots Q steady_shot Fluffy_Pillow 31.0/100: 31% focus precise_shots, trick_shots, potion_of_spectral_agility
5:36.020 trickshots F steady_shot Fluffy_Pillow 49.7/100: 50% focus precise_shots, trick_shots, potion_of_spectral_agility
5:37.501 trickshots N multishot Fluffy_Pillow 68.5/100: 68% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:38.689 trickshots L aimed_shot Fluffy_Pillow 56.0/100: 56% focus steady_focus, trick_shots

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Soulforge Embers }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="soulforge_embers"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7005,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

surging_shots : 7477 dps, 3789 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
7476.8 7476.8 12.5 / 0.168% 902.6 / 12.1% 749.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.0 9.8 Focus 0.00% 46.9 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
surging_shots 7477
Aimed Shot 2279 (2530) 30.5% (33.8%) 44.5 6.71sec 17067 10849 Direct 133.4 (147.6) 4193 8345 5133 22.6% (22.6%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.53 133.42 0.00 0.00 1.5731 0.0000 684925.96 978348.24 29.99% 10849.02 10849.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.36% 103.21 69 141 4193.01 2524 9967 4195.69 3788 4563 432726 618106 29.99%
crit 22.64% 30.21 14 49 8344.87 5048 19934 8355.38 6403 10388 252200 360242 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [K]:44.71
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 251 3.3% 0.0 0.00sec 0 0 Direct 14.2 4325 8597 5275 22.2%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 14.22 0.00 0.00 0.0000 0.0000 75047.58 107197.97 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.76% 11.06 2 20 4325.12 2524 9967 4357.86 3247 7226 47832 68324 29.99%
crit 22.24% 3.16 0 9 8596.54 5048 19934 8268.49 0 18806 27215 38874 28.72%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 345 4.6% 105.1 2.87sec 987 434 Direct 104.9 807 1615 989 22.6%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 105.09 104.85 0.00 0.00 2.2775 0.0000 103756.88 148206.33 29.99% 433.53 433.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.45% 81.21 59 107 807.32 774 1019 807.20 787 825 65560 93646 29.99%
crit 22.55% 23.65 6 45 1615.10 1548 2037 1614.99 1560 1708 38197 54560 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 138 1.8% 3.8 90.77sec 11039 0 Direct 3.7 9043 18097 11077 22.5%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.75 3.74 0.00 0.00 0.0000 0.0000 41428.66 41428.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.50% 2.90 0 4 9042.64 8937 9474 9022.61 0 9474 26204 26204 0.00%
crit 22.50% 0.84 0 4 18096.57 17875 18947 11281.43 0 18947 15225 15225 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.5% 21.8 13.33sec 547 0 Direct 21.8 446 892 547 22.7%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.85 21.85 0.00 0.00 0.0000 0.0000 11960.47 11960.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.28% 16.88 6 33 446.22 435 485 446.23 435 460 7534 7534 0.00%
crit 22.72% 4.96 0 14 891.95 871 969 888.25 0 969 4427 4427 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 79 1.1% 4.4 13.98sec 5403 4507 Direct 4.4 4248 9544 5440 22.5%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.40 4.37 0.00 0.00 1.1990 0.0000 23757.39 33935.06 29.99% 4507.19 4507.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.50% 3.38 0 7 4247.71 4065 4838 4227.21 0 4838 14378 20538 29.90%
crit 22.50% 0.98 0 4 9544.01 9146 10885 6506.84 0 10885 9379 13397 20.47%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [N]:4.40
  • if_expr:buff.dead_eye.down
Master Marksman 337 4.5% 212.7 1.42sec 476 0 Periodic 336.1 301 0 301 0.0% 74.5%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 212.74 0.00 336.11 336.11 0.0000 2.0000 101312.93 101312.93 0.00% 150.71 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 336.11 237 426 301.29 46 2777 301.51 237 401 101313 101313 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 1622 21.7% 83.7 3.58sec 5831 5109 Direct 250.4 1588 3177 1948 22.7%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 83.66 250.38 0.00 0.00 1.1414 0.0000 487798.45 696771.31 29.99% 5108.64 5108.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.35% 193.67 139 240 1588.44 953 2194 1588.14 1440 1705 307622 439408 29.99%
crit 22.65% 56.72 28 88 3177.19 1905 4389 3175.64 2775 3495 180176 257364 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [M]:76.36
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [O]:7.30
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 1212 16.2% 21.9 13.76sec 16633 9539 Periodic 473.9 626 1252 768 22.7% 3.6%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.89 0.00 158.50 473.93 1.7438 0.2060 364146.11 520146.31 29.99% 9538.61 9538.61
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.25% 366.12 226 529 625.90 439 1156 626.13 601 652 229170 327347 29.99%
crit 22.75% 107.80 63 162 1252.16 878 2313 1252.36 1113 1405 134976 192800 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [J]:21.08
  • if_expr:buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
    trickshots
    [L]:0.81
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.6% 43.7 6.81sec 300 0 Direct 43.7 245 491 300 22.4%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.73 43.73 0.00 0.00 0.0000 0.0000 13137.34 13137.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.59% 33.93 16 54 245.45 239 266 245.44 241 251 8327 8327 0.00%
crit 22.41% 9.80 2 23 490.88 479 533 490.83 479 510 4810 4810 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 316 4.2% 60.7 4.94sec 1567 1154 Direct 61.6 1260 2520 1544 22.5%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.70 61.59 0.00 0.00 1.3577 0.0000 95092.43 135830.03 29.99% 1153.94 1153.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.46% 47.71 29 68 1259.90 1219 1605 1259.43 1228 1296 60106 85855 29.99%
crit 22.54% 13.88 3 28 2519.80 2439 3210 2518.84 2439 2653 34987 49975 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:15.80
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [P]:45.15
Wild Spirits 30 (816) 0.4% (10.9%) 3.0 120.65sec 81749 74345 Direct 8.9 (135.8) 810 1622 997 23.1% (22.7%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 8.91 0.00 0.00 1.0999 0.0000 8880.78 8880.78 0.00% 74344.92 74344.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.95% 6.86 2 9 809.55 776 910 809.75 776 851 5550 5550 0.00%
crit 23.05% 2.05 0 6 1621.98 1552 1820 1454.69 0 1820 3331 3331 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 786 10.5% 42.3 6.10sec 5554 0 Direct 126.8 1509 3018 1851 22.7%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.28 126.84 0.00 0.00 0.0000 0.0000 234821.87 234821.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.33% 98.09 63 118 1509.28 1355 1699 1509.83 1485 1560 148038 148038 0.00%
crit 22.67% 28.76 13 48 3017.90 2711 3398 3019.22 2905 3216 86784 86784 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
surging_shots
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:surging_shots
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.79sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.98
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.61sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.64 0.00 0.00 0.00 0.9786 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.64
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:surging_shots
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:surging_shots
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 308.87sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.48
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.79sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.63% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • blood_fury_1:14.63%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.5sec 8.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • double_tap_1:8.40%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.0 0.2 33.2sec 32.4sec 2.4sec 6.34% 17.53% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 234.8s
  • trigger_min/max:1.8s / 234.8s
  • trigger_pct:7.81%
  • duration_min/max:0.0s / 10.3s

Stack Uptimes

  • lock_and_load_1:6.34%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.1sec 309.1sec 23.1sec 11.17% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.3s
  • trigger_min/max:300.0s / 332.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.17%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 41.6 3.0 7.2sec 6.7sec 2.4sec 33.77% 77.52% 1.5 (1.5) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 24.8s
  • trigger_min/max:0.9s / 15.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.6s

Stack Uptimes

  • precise_shots_1:29.85%
  • precise_shots_2:3.92%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 7.5 15.9 42.1sec 13.0sec 36.6sec 91.35% 0.00% 15.9 (15.9) 6.6

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 263.5s
  • trigger_min/max:4.0s / 54.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 260.1s

Stack Uptimes

  • steady_focus_1:91.35%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 67.2 16.5 4.5sec 3.6sec 4.0sec 90.03% 100.00% 16.5 (16.5) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.3s
  • trigger_min/max:0.9s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:90.03%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.1sec 19.01% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.7s

Stack Uptimes

  • trueshot_1:19.01%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.6sec 17.45% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.45%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.7 1.0 7.0 67.6s 47.1s 291.1s
Surging Shots Rapid Fire reset 6.7 0.0 16.0 39.1s 2.4s 267.6s
double_tap_rapid_fire 0.8 0.0 4.0 101.0s 55.4s 245.1s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 1.18% 0.68% 2.65% 0.7s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7220.0012.6942.7290.1598.032
Aimed Shot2.0360.0019.78721.5818.67138.714
Kill Shot4.4470.00135.25313.6430.17037.031
Wild Spirits0.7750.0022.6781.2990.0005.286
Trueshot0.8290.0012.9131.5690.2715.557
Rapid Fire1.4030.0019.58226.5289.57147.059

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
surging_shots
steady_shot Focus 61.68 596.81 20.32% 9.68 20.02 3.25%
rapid_fire Focus 158.54 154.84 5.27% 0.98 3.71 2.34%
focus_regen Focus 623.36 1940.07 66.06% 3.11 26.53 1.35%
Trueshot Focus 206.74 245.28 8.35% 1.19 6.56 2.61%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.76 9.96 56.9 38.9 0.1 100.0
Usage Type Count Total Avg RPE APR
surging_shots
aimed_shot Focus 44.5 1281.1 28.8 28.8 593.2
kill_shot Focus 4.4 43.9 10.0 10.0 540.8
multishot Focus 83.7 1673.2 20.0 20.0 291.5

Statistics & Data Analysis

Fight Length
surging_shots Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
surging_shots Damage Per Second
Count 1323
Mean 7476.81
Minimum 6806.32
Maximum 8258.95
Spread ( max - min ) 1452.64
Range [ ( max - min ) / 2 * 100% ] 9.71%
Standard Deviation 232.5064
5th Percentile 7099.42
95th Percentile 7874.81
( 95th Percentile - 5th Percentile ) 775.40
Mean Distribution
Standard Deviation 6.3923
95.00% Confidence Interval ( 7464.28 - 7489.34 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3715
0.1 Scale Factor Error with Delta=300 462
0.05 Scale Factor Error with Delta=300 1846
0.01 Scale Factor Error with Delta=300 46149
Priority Target DPS
surging_shots Priority Target Damage Per Second
Count 1323
Mean 3789.49
Minimum 3431.82
Maximum 4275.07
Spread ( max - min ) 843.25
Range [ ( max - min ) / 2 * 100% ] 11.13%
Standard Deviation 127.5436
5th Percentile 3596.62
95th Percentile 4010.03
( 95th Percentile - 5th Percentile ) 413.41
Mean Distribution
Standard Deviation 3.5065
95.00% Confidence Interval ( 3782.61 - 3796.36 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4352
0.1 Scale Factor Error with Delta=300 139
0.05 Scale Factor Error with Delta=300 556
0.01 Scale Factor Error with Delta=300 13887
DPS(e)
surging_shots Damage Per Second (Effective)
Count 1323
Mean 7476.81
Minimum 6806.32
Maximum 8258.95
Spread ( max - min ) 1452.64
Range [ ( max - min ) / 2 * 100% ] 9.71%
Damage
surging_shots Damage
Count 1323
Mean 2246066.86
Minimum 1675460.55
Maximum 2693547.73
Spread ( max - min ) 1018087.18
Range [ ( max - min ) / 2 * 100% ] 22.66%
DTPS
surging_shots Damage Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
surging_shots Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
surging_shots Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
surging_shots Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
surging_shots Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
surging_shots Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
surging_shotsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
surging_shots Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.76 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.98 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.48 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 15.80 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.64 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
J 21.08 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
K 44.71 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
L 0.81 rapid_fire,if=buff.trick_shots.remains>=execute_time
M 76.36 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
N 4.40 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
O 7.30 multishot,if=focus>cost+action.aimed_shot.cost
P 45.15 steady_shot

Sample Sequence

0125789FHIDEMKMJMKMKMJMKMKPFMJMKMKMPPPMKMPJMPKMPFOPOKMPGPFKMJMKMPFKMPMOPKMMJMKMPFPMK9MPKMJMPFPKMJMGPFKMKMJHIDMKMPFJMKMJMKMKMJMKMPFMKMPPPMJMKMPFGKMJMKMJ9MPFKMPMKMPPPKMJMPOKMPFMKMPPMKMJMPKGMPFMKMPHIDKPMJMKMPFJMKMKMJMKMPFK9MNPKMPFPJMKMNGPFMKMPNPKMJMPFNEKMJMPOKMJMNPFKMPP

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask surging_shots 100.0/100: 100% focus
Pre precombat 1 augmentation surging_shots 100.0/100: 100% focus
Pre precombat 2 food surging_shots 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.483 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.398 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.398 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.398 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.398 trickshots M multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.312 trickshots K aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.227 trickshots M multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.144 trickshots J rapid_fire Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.555 trickshots M multishot Fluffy_Pillow 87.7/100: 88% focus bloodlust, blood_fury, lock_and_load, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:07.470 trickshots K aimed_shot Fluffy_Pillow 79.0/100: 79% focus bloodlust, blood_fury, lock_and_load, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:08.386 trickshots M multishot Fluffy_Pillow 90.3/100: 90% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:09.302 trickshots K aimed_shot Fluffy_Pillow 81.6/100: 82% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.219 trickshots M multishot Fluffy_Pillow 57.9/100: 58% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.135 trickshots J rapid_fire Fluffy_Pillow 49.2/100: 49% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.645 trickshots M multishot Fluffy_Pillow 80.8/100: 81% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:13.560 trickshots K aimed_shot Fluffy_Pillow 72.1/100: 72% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.475 trickshots M multishot Fluffy_Pillow 48.4/100: 48% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:15.393 trickshots K aimed_shot Fluffy_Pillow 39.7/100: 40% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:16.310 trickshots P steady_shot Fluffy_Pillow 16.1/100: 16% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:17.379 trickshots F steady_shot Fluffy_Pillow 43.5/100: 44% focus bloodlust, blood_fury, precise_shots(2), trueshot, wild_spirits, potion_of_spectral_agility
0:18.520 trickshots M multishot Fluffy_Pillow 71.7/100: 72% focus bloodlust, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:19.436 trickshots J rapid_fire Fluffy_Pillow 63.0/100: 63% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:20.953 trickshots M multishot Fluffy_Pillow 91.7/100: 92% focus bloodlust, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:21.869 trickshots K aimed_shot Fluffy_Pillow 83.0/100: 83% focus bloodlust, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:22.782 trickshots M multishot Fluffy_Pillow 56.3/100: 56% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:23.698 trickshots K aimed_shot Fluffy_Pillow 43.8/100: 44% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:25.219 trickshots M multishot Fluffy_Pillow 21.3/100: 21% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:26.134 trickshots P steady_shot Fluffy_Pillow 8.8/100: 9% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:27.201 trickshots P steady_shot Fluffy_Pillow 27.6/100: 28% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:28.268 trickshots P steady_shot Fluffy_Pillow 46.4/100: 46% focus bloodlust, precise_shots, steady_focus, trick_shots
0:29.334 trickshots M multishot Fluffy_Pillow 65.2/100: 65% focus bloodlust, precise_shots, steady_focus, trick_shots
0:30.249 trickshots K aimed_shot Fluffy_Pillow 52.7/100: 53% focus bloodlust, steady_focus, trick_shots
0:31.773 trickshots M multishot Fluffy_Pillow 30.2/100: 30% focus bloodlust, precise_shots, steady_focus
0:32.689 trickshots P steady_shot Fluffy_Pillow 17.8/100: 18% focus bloodlust, steady_focus, trick_shots
0:33.755 trickshots J rapid_fire Fluffy_Pillow 36.6/100: 37% focus bloodlust, steady_focus, trick_shots
0:35.178 trickshots M multishot Fluffy_Pillow 55.3/100: 55% focus bloodlust, steady_focus
0:36.093 trickshots P steady_shot Fluffy_Pillow 42.8/100: 43% focus bloodlust, steady_focus, trick_shots
0:37.161 trickshots K aimed_shot Fluffy_Pillow 61.6/100: 62% focus bloodlust, steady_focus, trick_shots
0:38.737 trickshots M multishot Fluffy_Pillow 39.5/100: 40% focus bloodlust, precise_shots, steady_focus
0:39.653 trickshots P steady_shot Fluffy_Pillow 27.1/100: 27% focus bloodlust, steady_focus, trick_shots
0:40.719 trickshots F steady_shot Fluffy_Pillow 45.9/100: 46% focus bloodlust, steady_focus, trick_shots
0:41.787 trickshots O multishot Fluffy_Pillow 63.1/100: 63% focus steady_focus, trick_shots
0:42.975 trickshots P steady_shot Fluffy_Pillow 50.7/100: 51% focus steady_focus, trick_shots
0:44.362 trickshots O multishot Fluffy_Pillow 69.4/100: 69% focus steady_focus, trick_shots
0:45.550 trickshots K aimed_shot Fluffy_Pillow 57.0/100: 57% focus steady_focus, trick_shots
0:47.534 trickshots M multishot Fluffy_Pillow 34.5/100: 35% focus precise_shots, steady_focus
0:48.721 trickshots P steady_shot Fluffy_Pillow 22.0/100: 22% focus steady_focus, trick_shots
0:50.107 trickshots G double_tap Fluffy_Pillow 40.8/100: 41% focus steady_focus, trick_shots
0:51.293 trickshots P steady_shot Fluffy_Pillow 48.3/100: 48% focus double_tap, steady_focus, trick_shots
0:52.679 trickshots F steady_shot Fluffy_Pillow 67.1/100: 67% focus double_tap, steady_focus, trick_shots
0:54.066 trickshots K aimed_shot Fluffy_Pillow 85.9/100: 86% focus double_tap, lock_and_load, steady_focus, trick_shots
0:55.256 trickshots M multishot Fluffy_Pillow 93.4/100: 93% focus precise_shots, steady_focus
0:56.445 trickshots J rapid_fire Fluffy_Pillow 80.9/100: 81% focus steady_focus, trick_shots
0:58.336 trickshots M multishot Fluffy_Pillow 99.9/100: 100% focus steady_focus
0:59.523 trickshots K aimed_shot Fluffy_Pillow 87.4/100: 87% focus steady_focus, trick_shots
1:01.501 trickshots M multishot Fluffy_Pillow 64.9/100: 65% focus precise_shots, steady_focus
1:02.691 trickshots P steady_shot Fluffy_Pillow 52.5/100: 52% focus steady_focus, trick_shots
1:04.079 trickshots F steady_shot Fluffy_Pillow 71.2/100: 71% focus steady_focus, trick_shots
1:05.464 trickshots K aimed_shot Fluffy_Pillow 90.0/100: 90% focus steady_focus, trick_shots
1:07.442 trickshots M multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots(2), steady_focus
1:08.630 trickshots P steady_shot Fluffy_Pillow 52.5/100: 53% focus precise_shots, steady_focus, trick_shots
1:10.015 trickshots M multishot Fluffy_Pillow 71.3/100: 71% focus precise_shots, steady_focus, trick_shots
1:11.202 trickshots O multishot Fluffy_Pillow 58.8/100: 59% focus steady_focus, trick_shots
1:12.391 trickshots P steady_shot Fluffy_Pillow 46.3/100: 46% focus steady_focus, trick_shots
1:13.778 trickshots K aimed_shot Fluffy_Pillow 65.1/100: 65% focus lock_and_load, steady_focus, trick_shots
1:14.965 trickshots M multishot Fluffy_Pillow 72.6/100: 73% focus precise_shots(2), steady_focus
1:16.154 trickshots M multishot Fluffy_Pillow 60.2/100: 60% focus precise_shots, steady_focus, trick_shots
1:17.343 trickshots J rapid_fire Fluffy_Pillow 47.7/100: 48% focus steady_focus, trick_shots
1:18.999 trickshots M multishot Fluffy_Pillow 65.2/100: 65% focus steady_focus
1:20.187 trickshots K aimed_shot Fluffy_Pillow 52.7/100: 53% focus steady_focus, trick_shots
1:22.164 trickshots M multishot Fluffy_Pillow 29.5/100: 29% focus precise_shots(2)
1:23.434 trickshots P steady_shot Fluffy_Pillow 17.0/100: 17% focus precise_shots, trick_shots
1:24.917 trickshots F steady_shot Fluffy_Pillow 35.8/100: 36% focus precise_shots, trick_shots
1:26.400 trickshots P steady_shot Fluffy_Pillow 54.6/100: 55% focus precise_shots, steady_focus, trick_shots
1:27.787 trickshots M multishot Fluffy_Pillow 73.3/100: 73% focus precise_shots, steady_focus, trick_shots
1:28.973 trickshots K aimed_shot Fluffy_Pillow 60.8/100: 61% focus steady_focus, trick_shots
1:30.951 default 9 use_items Fluffy_Pillow 38.4/100: 38% focus precise_shots, steady_focus
1:30.951 trickshots M multishot Fluffy_Pillow 38.4/100: 38% focus precise_shots, steady_focus
1:32.139 trickshots P steady_shot Fluffy_Pillow 25.9/100: 26% focus steady_focus, trick_shots
1:33.526 trickshots K aimed_shot Fluffy_Pillow 44.7/100: 45% focus steady_focus, trick_shots
1:35.502 trickshots M multishot Fluffy_Pillow 22.2/100: 22% focus precise_shots, steady_focus
1:36.691 trickshots J rapid_fire Fluffy_Pillow 9.7/100: 10% focus steady_focus, trick_shots
1:38.426 trickshots M multishot Fluffy_Pillow 27.7/100: 28% focus steady_focus
1:39.614 trickshots P steady_shot Fluffy_Pillow 15.2/100: 15% focus steady_focus, trick_shots
1:41.000 trickshots F steady_shot Fluffy_Pillow 34.0/100: 34% focus steady_focus, trick_shots
1:42.386 trickshots P steady_shot Fluffy_Pillow 52.3/100: 52% focus steady_focus, trick_shots
1:43.773 trickshots K aimed_shot Fluffy_Pillow 71.1/100: 71% focus steady_focus, trick_shots
1:45.752 trickshots M multishot Fluffy_Pillow 48.6/100: 49% focus precise_shots(2), steady_focus
1:46.941 trickshots J rapid_fire Fluffy_Pillow 36.2/100: 36% focus precise_shots, steady_focus, trick_shots
1:48.713 trickshots M multishot Fluffy_Pillow 54.4/100: 54% focus precise_shots, steady_focus
1:49.902 trickshots G double_tap Fluffy_Pillow 41.9/100: 42% focus steady_focus, trick_shots
1:51.294 trickshots P steady_shot Fluffy_Pillow 50.7/100: 51% focus double_tap, steady_focus, trick_shots
1:52.680 trickshots F steady_shot Fluffy_Pillow 69.5/100: 69% focus double_tap, lock_and_load, steady_focus, trick_shots
1:54.067 trickshots K aimed_shot Fluffy_Pillow 88.3/100: 88% focus double_tap, lock_and_load, steady_focus, trick_shots
1:55.254 trickshots M multishot Fluffy_Pillow 95.8/100: 96% focus precise_shots, steady_focus
1:56.442 trickshots K aimed_shot Fluffy_Pillow 83.3/100: 83% focus steady_focus, trick_shots
1:58.421 trickshots M multishot Fluffy_Pillow 60.8/100: 61% focus precise_shots(2), steady_focus
1:59.608 trickshots J rapid_fire Fluffy_Pillow 48.3/100: 48% focus precise_shots, steady_focus, trick_shots
2:01.414 trickshots H wild_spirits Fluffy_Pillow 66.8/100: 67% focus precise_shots, steady_focus
2:02.671 trickshots I trueshot Fluffy_Pillow 74.7/100: 75% focus precise_shots, steady_focus
2:02.671 cds D blood_fury Fluffy_Pillow 74.7/100: 75% focus precise_shots, steady_focus, trueshot
2:02.671 trickshots M multishot Fluffy_Pillow 74.7/100: 75% focus blood_fury, precise_shots, steady_focus, trueshot
2:03.859 trickshots K aimed_shot Fluffy_Pillow 66.0/100: 66% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:05.048 trickshots M multishot Fluffy_Pillow 42.3/100: 42% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:06.237 trickshots P steady_shot Fluffy_Pillow 33.6/100: 34% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:07.624 trickshots F steady_shot Fluffy_Pillow 61.7/100: 62% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:09.011 trickshots J rapid_fire Fluffy_Pillow 89.9/100: 90% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:10.754 trickshots M multishot Fluffy_Pillow 100.0/100: 100% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:11.942 trickshots K aimed_shot Fluffy_Pillow 91.3/100: 91% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:13.131 trickshots M multishot Fluffy_Pillow 66.9/100: 67% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:14.320 trickshots J rapid_fire Fluffy_Pillow 58.2/100: 58% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:16.058 trickshots M multishot Fluffy_Pillow 87.7/100: 88% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:17.248 trickshots K aimed_shot Fluffy_Pillow 79.0/100: 79% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:18.436 trickshots M multishot Fluffy_Pillow 55.3/100: 55% focus precise_shots(2), steady_focus, trueshot, wild_spirits
2:19.624 trickshots K aimed_shot Fluffy_Pillow 46.6/100: 47% focus lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:20.814 trickshots M multishot Fluffy_Pillow 57.9/100: 58% focus precise_shots(2), steady_focus, trueshot, wild_spirits
2:22.002 trickshots J rapid_fire Fluffy_Pillow 49.1/100: 49% focus precise_shots, steady_focus, trick_shots, trueshot
2:23.753 trickshots M multishot Fluffy_Pillow 68.2/100: 68% focus precise_shots, steady_focus
2:24.943 trickshots K aimed_shot Fluffy_Pillow 55.4/100: 55% focus trick_shots
2:27.060 trickshots M multishot Fluffy_Pillow 32.9/100: 33% focus precise_shots(2)
2:28.331 trickshots P steady_shot Fluffy_Pillow 20.4/100: 20% focus precise_shots, trick_shots
2:29.814 trickshots F steady_shot Fluffy_Pillow 39.2/100: 39% focus precise_shots, trick_shots
2:31.296 trickshots M multishot Fluffy_Pillow 58.0/100: 58% focus precise_shots, steady_focus, trick_shots
2:32.485 trickshots K aimed_shot Fluffy_Pillow 45.5/100: 45% focus steady_focus, trick_shots
2:34.463 trickshots M multishot Fluffy_Pillow 23.0/100: 23% focus precise_shots(2), steady_focus
2:35.652 trickshots P steady_shot Fluffy_Pillow 10.5/100: 11% focus precise_shots, steady_focus, trick_shots
2:37.036 trickshots P steady_shot Fluffy_Pillow 29.3/100: 29% focus precise_shots, steady_focus, trick_shots
2:38.423 trickshots P steady_shot Fluffy_Pillow 48.1/100: 48% focus precise_shots, steady_focus, trick_shots
2:39.810 trickshots M multishot Fluffy_Pillow 66.8/100: 67% focus precise_shots, steady_focus, trick_shots
2:41.000 trickshots J rapid_fire Fluffy_Pillow 54.4/100: 54% focus steady_focus, trick_shots
2:42.899 trickshots M multishot Fluffy_Pillow 73.4/100: 73% focus steady_focus
2:44.086 trickshots K aimed_shot Fluffy_Pillow 60.9/100: 61% focus steady_focus, trick_shots
2:46.064 trickshots M multishot Fluffy_Pillow 38.4/100: 38% focus precise_shots, steady_focus
2:47.253 trickshots P steady_shot Fluffy_Pillow 25.9/100: 26% focus steady_focus, trick_shots
2:48.640 trickshots F steady_shot Fluffy_Pillow 44.7/100: 45% focus steady_focus, trick_shots
2:50.028 trickshots G double_tap Fluffy_Pillow 63.5/100: 64% focus steady_focus, trick_shots
2:51.296 trickshots K aimed_shot Fluffy_Pillow 71.5/100: 72% focus double_tap, steady_focus, trick_shots
2:53.275 trickshots M multishot Fluffy_Pillow 49.1/100: 49% focus precise_shots, steady_focus
2:54.464 trickshots J rapid_fire Fluffy_Pillow 36.6/100: 37% focus steady_focus, trick_shots
2:56.290 trickshots M multishot Fluffy_Pillow 55.1/100: 55% focus steady_focus
2:57.478 trickshots K aimed_shot Fluffy_Pillow 42.7/100: 43% focus steady_focus, trick_shots
2:59.457 trickshots M multishot Fluffy_Pillow 20.2/100: 20% focus precise_shots, steady_focus
3:00.645 trickshots J rapid_fire Fluffy_Pillow 7.7/100: 8% focus steady_focus, trick_shots
3:02.326 default 9 use_items Fluffy_Pillow 25.3/100: 25% focus steady_focus
3:02.326 trickshots M multishot Fluffy_Pillow 25.3/100: 25% focus steady_focus
3:03.517 trickshots P steady_shot Fluffy_Pillow 12.9/100: 13% focus steady_focus, trick_shots
3:04.903 trickshots F steady_shot Fluffy_Pillow 31.7/100: 32% focus steady_focus, trick_shots
3:06.291 trickshots K aimed_shot Fluffy_Pillow 49.9/100: 50% focus steady_focus, trick_shots
3:08.269 trickshots M multishot Fluffy_Pillow 27.4/100: 27% focus lock_and_load, precise_shots(2), steady_focus
3:09.457 trickshots P steady_shot Fluffy_Pillow 15.0/100: 15% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:10.844 trickshots M multishot Fluffy_Pillow 33.7/100: 34% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:12.033 trickshots K aimed_shot Fluffy_Pillow 21.3/100: 21% focus lock_and_load, steady_focus, trick_shots
3:13.222 trickshots M multishot Fluffy_Pillow 28.8/100: 29% focus precise_shots, steady_focus
3:14.410 trickshots P steady_shot Fluffy_Pillow 16.3/100: 16% focus steady_focus, trick_shots
3:15.796 trickshots P steady_shot Fluffy_Pillow 35.1/100: 35% focus steady_focus, trick_shots
3:17.183 trickshots P steady_shot Fluffy_Pillow 53.9/100: 54% focus steady_focus, trick_shots
3:18.569 trickshots K aimed_shot Fluffy_Pillow 72.6/100: 73% focus steady_focus, trick_shots
3:20.549 trickshots M multishot Fluffy_Pillow 50.2/100: 50% focus precise_shots(2), steady_focus
3:21.738 trickshots J rapid_fire Fluffy_Pillow 37.7/100: 38% focus precise_shots, steady_focus, trick_shots
3:23.632 trickshots M multishot Fluffy_Pillow 56.7/100: 57% focus precise_shots, steady_focus
3:24.821 trickshots P steady_shot Fluffy_Pillow 44.2/100: 44% focus steady_focus, trick_shots
3:26.206 trickshots O multishot Fluffy_Pillow 63.0/100: 63% focus steady_focus, trick_shots
3:27.393 trickshots K aimed_shot Fluffy_Pillow 50.5/100: 50% focus steady_focus, trick_shots
3:29.370 trickshots M multishot Fluffy_Pillow 28.0/100: 28% focus precise_shots(2), steady_focus
3:30.560 trickshots P steady_shot Fluffy_Pillow 15.5/100: 16% focus precise_shots, steady_focus, trick_shots
3:31.946 trickshots F steady_shot Fluffy_Pillow 34.3/100: 34% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:33.331 trickshots M multishot Fluffy_Pillow 52.6/100: 53% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:34.521 trickshots K aimed_shot Fluffy_Pillow 40.1/100: 40% focus lock_and_load, steady_focus, trick_shots
3:35.711 trickshots M multishot Fluffy_Pillow 47.7/100: 48% focus precise_shots(2), steady_focus
3:36.901 trickshots P steady_shot Fluffy_Pillow 35.2/100: 35% focus precise_shots, steady_focus, trick_shots
3:38.288 trickshots P steady_shot Fluffy_Pillow 54.0/100: 54% focus precise_shots, steady_focus, trick_shots
3:39.674 trickshots M multishot Fluffy_Pillow 72.7/100: 73% focus precise_shots, steady_focus, trick_shots
3:40.859 trickshots K aimed_shot Fluffy_Pillow 60.2/100: 60% focus steady_focus, trick_shots
3:42.837 trickshots M multishot Fluffy_Pillow 37.8/100: 38% focus precise_shots, steady_focus
3:44.026 trickshots J rapid_fire Fluffy_Pillow 25.3/100: 25% focus steady_focus, trick_shots
3:45.885 trickshots M multishot Fluffy_Pillow 44.0/100: 44% focus steady_focus
3:47.072 trickshots P steady_shot Fluffy_Pillow 31.6/100: 32% focus steady_focus, trick_shots
3:48.460 trickshots K aimed_shot Fluffy_Pillow 50.3/100: 50% focus steady_focus, trick_shots
3:50.438 trickshots G double_tap Fluffy_Pillow 27.9/100: 28% focus precise_shots(2), steady_focus
3:51.627 trickshots M multishot Fluffy_Pillow 35.4/100: 35% focus double_tap, precise_shots(2), steady_focus
3:52.816 trickshots P steady_shot Fluffy_Pillow 22.9/100: 23% focus double_tap, precise_shots, steady_focus, trick_shots
3:54.204 trickshots F steady_shot Fluffy_Pillow 41.7/100: 42% focus double_tap, precise_shots, steady_focus, trick_shots
3:55.591 trickshots M multishot Fluffy_Pillow 60.1/100: 60% focus double_tap, precise_shots, steady_focus, trick_shots
3:56.780 trickshots K aimed_shot Fluffy_Pillow 47.6/100: 48% focus double_tap, steady_focus, trick_shots
3:58.759 trickshots M multishot Fluffy_Pillow 25.1/100: 25% focus precise_shots(2), steady_focus
3:59.948 trickshots P steady_shot Fluffy_Pillow 12.7/100: 13% focus precise_shots, steady_focus, trick_shots
4:01.334 trickshots H wild_spirits Fluffy_Pillow 31.4/100: 31% focus precise_shots, steady_focus, trick_shots
4:02.671 trickshots I trueshot Fluffy_Pillow 39.9/100: 40% focus precise_shots, steady_focus, trick_shots
4:02.671 cds D blood_fury Fluffy_Pillow 39.9/100: 40% focus precise_shots, steady_focus, trick_shots, trueshot
4:02.671 trickshots K aimed_shot Fluffy_Pillow 39.9/100: 40% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:03.968 trickshots P steady_shot Fluffy_Pillow 17.2/100: 17% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:05.356 trickshots M multishot Fluffy_Pillow 45.4/100: 45% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:06.545 trickshots J rapid_fire Fluffy_Pillow 36.7/100: 37% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:08.444 trickshots M multishot Fluffy_Pillow 66.7/100: 67% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:09.633 trickshots K aimed_shot Fluffy_Pillow 58.0/100: 58% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:10.821 trickshots M multishot Fluffy_Pillow 34.1/100: 34% focus blood_fury, precise_shots, trueshot, wild_spirits
4:12.093 trickshots P steady_shot Fluffy_Pillow 25.4/100: 25% focus blood_fury, trick_shots, trueshot, wild_spirits
4:13.577 trickshots F steady_shot Fluffy_Pillow 53.6/100: 54% focus blood_fury, trick_shots, trueshot, wild_spirits
4:15.062 trickshots J rapid_fire Fluffy_Pillow 81.8/100: 82% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:16.817 trickshots M multishot Fluffy_Pillow 100.0/100: 100% focus blood_fury, steady_focus, trueshot, wild_spirits
4:18.007 trickshots K aimed_shot Fluffy_Pillow 91.3/100: 91% focus steady_focus, trick_shots, trueshot, wild_spirits
4:19.195 trickshots M multishot Fluffy_Pillow 66.9/100: 67% focus precise_shots, steady_focus, trueshot, wild_spirits
4:20.380 trickshots K aimed_shot Fluffy_Pillow 58.2/100: 58% focus steady_focus, trick_shots, trueshot, wild_spirits
4:21.568 trickshots M multishot Fluffy_Pillow 34.4/100: 34% focus precise_shots(2), steady_focus, trueshot
4:22.756 trickshots J rapid_fire Fluffy_Pillow 24.3/100: 24% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:24.476 trickshots M multishot Fluffy_Pillow 42.2/100: 42% focus lock_and_load, precise_shots, steady_focus
4:25.664 trickshots K aimed_shot Fluffy_Pillow 29.7/100: 30% focus lock_and_load, steady_focus, trick_shots
4:26.853 trickshots M multishot Fluffy_Pillow 37.3/100: 37% focus precise_shots, steady_focus
4:28.042 trickshots P steady_shot Fluffy_Pillow 24.8/100: 25% focus steady_focus, trick_shots
4:29.429 trickshots F steady_shot Fluffy_Pillow 43.6/100: 44% focus steady_focus, trick_shots
4:30.817 trickshots K aimed_shot Fluffy_Pillow 62.0/100: 62% focus steady_focus, trick_shots
4:32.795 default 9 use_items Fluffy_Pillow 39.6/100: 40% focus precise_shots, steady_focus
4:32.795 trickshots M multishot Fluffy_Pillow 39.6/100: 40% focus precise_shots, steady_focus
4:33.981 trickshots N kill_shot Fluffy_Pillow 27.1/100: 27% focus steady_focus, trick_shots
4:35.169 trickshots P steady_shot Fluffy_Pillow 24.6/100: 25% focus steady_focus, trick_shots
4:36.556 trickshots K aimed_shot Fluffy_Pillow 43.4/100: 43% focus steady_focus, trick_shots
4:38.533 trickshots M multishot Fluffy_Pillow 20.9/100: 21% focus precise_shots, steady_focus
4:39.722 trickshots P steady_shot Fluffy_Pillow 8.4/100: 8% focus steady_focus, trick_shots
4:41.108 trickshots F steady_shot Fluffy_Pillow 27.2/100: 27% focus steady_focus, trick_shots
4:42.493 trickshots P steady_shot Fluffy_Pillow 45.9/100: 46% focus steady_focus, trick_shots
4:43.880 trickshots J rapid_fire Fluffy_Pillow 64.7/100: 65% focus steady_focus, trick_shots
4:45.716 trickshots M multishot Fluffy_Pillow 83.3/100: 83% focus steady_focus
4:46.905 trickshots K aimed_shot Fluffy_Pillow 70.9/100: 71% focus steady_focus, trick_shots
4:48.883 trickshots M multishot Fluffy_Pillow 48.4/100: 48% focus precise_shots(2), steady_focus
4:50.071 trickshots N kill_shot Fluffy_Pillow 35.9/100: 36% focus precise_shots, steady_focus, trick_shots
4:51.259 trickshots G double_tap Fluffy_Pillow 33.4/100: 33% focus precise_shots, steady_focus, trick_shots
4:52.447 trickshots P steady_shot Fluffy_Pillow 40.9/100: 41% focus double_tap, precise_shots, steady_focus, trick_shots
4:53.833 trickshots F steady_shot Fluffy_Pillow 59.7/100: 60% focus double_tap, precise_shots, steady_focus, trick_shots
4:55.219 trickshots M multishot Fluffy_Pillow 78.5/100: 78% focus double_tap, precise_shots, steady_focus, trick_shots
4:56.408 trickshots K aimed_shot Fluffy_Pillow 66.0/100: 66% focus double_tap, steady_focus, trick_shots
4:58.387 trickshots M multishot Fluffy_Pillow 43.5/100: 44% focus precise_shots, steady_focus
4:59.577 trickshots P steady_shot Fluffy_Pillow 31.1/100: 31% focus steady_focus, trick_shots
5:00.964 trickshots N kill_shot Fluffy_Pillow 49.9/100: 50% focus steady_focus, trick_shots
5:02.151 trickshots P steady_shot Fluffy_Pillow 47.4/100: 47% focus steady_focus, trick_shots
5:03.537 trickshots K aimed_shot Fluffy_Pillow 66.1/100: 66% focus steady_focus, trick_shots
5:05.609 trickshots M multishot Fluffy_Pillow 44.3/100: 44% focus precise_shots, steady_focus
5:06.798 trickshots J rapid_fire Fluffy_Pillow 31.8/100: 32% focus steady_focus, trick_shots
5:08.646 trickshots M multishot Fluffy_Pillow 50.5/100: 50% focus steady_focus
5:09.836 trickshots P steady_shot Fluffy_Pillow 38.0/100: 38% focus steady_focus, trick_shots
5:11.223 trickshots F steady_shot Fluffy_Pillow 56.4/100: 56% focus trick_shots
5:12.706 trickshots N kill_shot Fluffy_Pillow 75.1/100: 75% focus steady_focus, trick_shots
5:13.894 cds E potion Fluffy_Pillow 72.7/100: 73% focus steady_focus, trick_shots
5:13.894 trickshots K aimed_shot Fluffy_Pillow 72.7/100: 73% focus steady_focus, trick_shots, potion_of_spectral_agility
5:15.873 trickshots M multishot Fluffy_Pillow 50.2/100: 50% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:17.062 trickshots J rapid_fire Fluffy_Pillow 37.7/100: 38% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:18.887 trickshots M multishot Fluffy_Pillow 56.3/100: 56% focus precise_shots, steady_focus, potion_of_spectral_agility
5:20.077 trickshots P steady_shot Fluffy_Pillow 43.8/100: 44% focus steady_focus, trick_shots, potion_of_spectral_agility
5:21.463 trickshots O multishot Fluffy_Pillow 62.6/100: 63% focus steady_focus, trick_shots, potion_of_spectral_agility
5:22.651 trickshots K aimed_shot Fluffy_Pillow 50.1/100: 50% focus steady_focus, trick_shots, potion_of_spectral_agility
5:24.728 trickshots M multishot Fluffy_Pillow 28.2/100: 28% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:25.916 trickshots J rapid_fire Fluffy_Pillow 15.7/100: 16% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:27.697 trickshots M multishot Fluffy_Pillow 34.0/100: 34% focus precise_shots, steady_focus, potion_of_spectral_agility
5:28.887 trickshots N kill_shot Fluffy_Pillow 21.1/100: 21% focus trick_shots, potion_of_spectral_agility
5:30.158 trickshots P steady_shot Fluffy_Pillow 18.6/100: 19% focus trick_shots, potion_of_spectral_agility
5:31.643 trickshots F steady_shot Fluffy_Pillow 37.4/100: 37% focus trick_shots, potion_of_spectral_agility
5:33.126 trickshots K aimed_shot Fluffy_Pillow 56.1/100: 56% focus steady_focus, trick_shots, potion_of_spectral_agility
5:35.105 trickshots M multishot Fluffy_Pillow 33.7/100: 34% focus precise_shots, steady_focus, potion_of_spectral_agility
5:36.294 trickshots P steady_shot Fluffy_Pillow 21.2/100: 21% focus steady_focus, trick_shots, potion_of_spectral_agility
5:37.681 trickshots P steady_shot Fluffy_Pillow 40.0/100: 40% focus steady_focus, trick_shots, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Surging Shots }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="surging_shots"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7012,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

trapping_app : 7257 dps, 3710 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
7257.2 7257.2 11.7 / 0.162% 828.6 / 11.4% 715.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.1 9.9 Focus 0.00% 47.4 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
trapping_app 7257
Aimed Shot 2466 (2710) 34.0% (37.3%) 47.8 6.24sec 17023 11015 Direct 143.3 (157.1) 4221 8415 5171 22.6% (22.6%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.82 143.32 0.00 0.00 1.5455 0.0000 741075.82 1058552.70 29.99% 11014.91 11014.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.36% 110.87 78 149 4221.43 2524 9967 4224.82 3902 4606 468086 668614 29.99%
crit 22.64% 32.45 17 52 8414.55 5048 19934 8416.83 6693 10627 272990 389939 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:48.01
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 244 3.3% 0.0 0.00sec 0 0 Direct 13.7 4333 8670 5311 22.5%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.75 0.00 0.00 0.0000 0.0000 73014.25 104293.56 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.46% 10.65 2 17 4332.94 2524 9967 4370.57 3196 6285 46136 65900 29.99%
crit 22.54% 3.10 0 10 8669.76 5048 19934 8319.16 0 19934 26879 38393 28.63%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 374 5.2% 113.0 2.67sec 995 438 Direct 112.8 811 1625 997 22.8%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.00 112.75 0.00 0.00 2.2689 0.0000 112421.67 160583.11 29.99% 438.50 438.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.17% 87.01 64 115 811.24 774 1019 811.17 796 824 70591 100833 29.99%
crit 22.83% 25.74 11 43 1624.90 1548 2037 1624.74 1564 1715 41830 59751 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 137 1.9% 3.8 90.73sec 10975 0 Direct 3.7 9051 18086 11018 21.8%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.75 3.74 0.00 0.00 0.0000 0.0000 41203.97 41203.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.21% 2.92 0 4 9050.59 8937 9474 9010.86 0 9474 26468 26468 0.00%
crit 21.79% 0.81 0 4 18086.00 17875 18947 10926.98 0 18947 14736 14736 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.6% 21.9 13.47sec 549 0 Direct 21.9 446 893 549 22.9%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.89 21.89 0.00 0.00 0.0000 0.0000 12006.78 12006.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.09% 16.87 6 31 446.27 435 485 446.29 435 465 7530 7530 0.00%
crit 22.91% 5.01 0 14 892.69 871 969 886.71 0 969 4476 4476 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 82 1.1% 4.6 13.59sec 5421 4539 Direct 4.5 4256 9585 5468 22.7%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.57 4.54 0.00 0.00 1.1944 0.0000 24792.02 35412.92 29.99% 4539.00 4539.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.30% 3.51 0 7 4256.44 4065 4838 4246.38 0 4685 14923 21316 29.95%
crit 22.70% 1.03 0 4 9585.21 9146 10885 6483.35 0 10885 9869 14097 20.29%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:4.57
  • if_expr:buff.dead_eye.down
Master Marksman 322 4.4% 189.3 1.58sec 511 0 Periodic 321.2 301 0 301 0.0% 71.2%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.29 0.00 321.23 321.23 0.0000 2.0000 96771.69 96771.69 0.00% 150.63 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 321.23 230 414 301.34 37 2621 301.24 229 382 96772 96772 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 1624 22.4% 81.8 3.66sec 5970 5233 Direct 244.9 1627 3251 1994 22.6%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 81.80 244.88 0.00 0.00 1.1410 0.0000 488382.74 697605.91 29.99% 5232.52 5232.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.37% 189.47 137 243 1626.76 953 2194 1626.69 1521 1740 308250 440304 29.99%
crit 22.63% 55.41 33 87 3250.82 1905 4389 3250.36 2885 3532 180133 257302 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:74.39
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:7.41
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 733 10.1% 16.4 18.30sec 13399 7624 Periodic 363.3 495 989 607 22.6% 2.7%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.45 0.00 121.50 363.27 1.7576 0.2037 220351.77 314750.47 29.99% 7623.57 7623.57
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.39% 281.12 183 397 494.69 351 925 494.73 474 515 139067 198643 29.99%
crit 22.61% 82.15 47 134 989.39 703 1850 989.56 873 1150 81285 116108 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:16.45
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.6% 43.6 6.74sec 301 0 Direct 43.6 245 491 301 22.7%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.62 43.62 0.00 0.00 0.0000 0.0000 13139.95 13139.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.30% 33.72 17 57 245.46 239 266 245.47 241 251 8278 8278 0.00%
crit 22.70% 9.90 1 22 491.07 479 533 491.09 479 533 4862 4862 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 348 4.8% 66.6 4.51sec 1571 1166 Direct 67.5 1266 2530 1550 22.5%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.62 67.51 0.00 0.00 1.3476 0.0000 104671.44 149512.68 29.99% 1165.90 1165.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.52% 52.33 32 70 1266.26 1219 1605 1266.08 1237 1291 66269 94659 29.99%
crit 22.48% 15.18 5 31 2529.80 2439 3210 2529.63 2439 2713 38402 54854 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.34
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:50.56
Wild Spirits 30 (844) 0.4% (11.6%) 3.0 120.65sec 84611 76987 Direct 8.9 (140.5) 810 1619 991 22.4% (22.6%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 8.90 0.00 0.00 1.0991 0.0000 8824.51 8824.51 0.00% 76986.57 76986.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.63% 6.91 2 9 810.14 776 910 810.29 776 858 5601 5601 0.00%
crit 22.37% 1.99 0 7 1618.76 1552 1820 1452.56 0 1820 3224 3224 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 815 11.2% 43.9 5.88sec 5553 0 Direct 131.6 1509 3018 1851 22.7%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.86 131.57 0.00 0.00 0.0000 0.0000 243537.47 243537.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.34% 101.76 65 120 1509.02 1355 1699 1509.67 1486 1555 153561 153561 0.00%
crit 22.66% 29.82 13 47 3017.61 2711 3398 3018.89 2933 3159 89976 89976 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
trapping_app
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:trapping_app
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.77sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.60sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 0.00 0.00 0.00 0.9779 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.63
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:trapping_app
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:trapping_app
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 308.96sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.48
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.79sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.63% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • blood_fury_1:14.63%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.5sec 8.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • double_tap_1:8.36%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.9 0.2 30.4sec 29.6sec 1.8sec 5.41% 18.24% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 245.9s
  • trigger_min/max:1.8s / 245.9s
  • trigger_pct:8.09%
  • duration_min/max:0.0s / 11.4s

Stack Uptimes

  • lock_and_load_1:5.41%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.0sec 309.0sec 23.1sec 11.17% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.2s
  • trigger_min/max:300.0s / 332.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.17%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.3 7.6 7.4sec 6.3sec 2.9sec 38.82% 82.51% 3.8 (3.8) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 40.2s
  • trigger_min/max:0.9s / 14.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 34.2s

Stack Uptimes

  • precise_shots_1:33.40%
  • precise_shots_2:5.42%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 6.2 18.7 51.8sec 12.2sec 45.9sec 94.37% 0.00% 18.7 (18.7) 5.3

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 283.5s
  • trigger_min/max:4.0s / 46.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 312.9s

Stack Uptimes

  • steady_focus_1:94.37%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 65.1 16.7 4.6sec 3.7sec 4.1sec 88.68% 100.00% 16.7 (16.7) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 13.8s
  • trigger_min/max:0.9s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:88.68%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.2sec 19.00% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • trueshot_1:19.00%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.6sec 17.45% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.45%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.9sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.3s / 359.6s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.6 1.0 7.0 69.3s 47.1s 295.2s
double_tap_rapid_fire 1.0 0.0 4.0 94.2s 54.8s 302.7s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.87% 0.68% 1.83% 0.9s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7370.0012.7092.8110.0396.912
Aimed Shot1.2760.0016.98413.6364.65926.046
Kill Shot3.9000.00124.44612.9270.06529.167
Wild Spirits0.7630.0012.7031.2870.0004.614
Trueshot0.8340.0012.9161.5590.2714.888
Rapid Fire3.1230.00123.59942.25619.10269.468

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
trapping_app
steady_shot Focus 67.61 656.10 22.00% 9.70 20.03 2.96%
rapid_fire Focus 121.50 121.27 4.07% 1.00 0.23 0.19%
focus_regen Focus 611.21 1951.16 65.44% 3.19 19.30 0.98%
Trueshot Focus 192.28 253.06 8.49% 1.32 0.89 0.35%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.91 10.12 40.5 36.2 0.6 95.7
Usage Type Count Total Avg RPE APR
trapping_app
aimed_shot Focus 47.8 1363.6 28.5 28.5 597.0
kill_shot Focus 4.6 45.7 10.0 10.0 542.2
multishot Focus 81.8 1636.0 20.0 20.0 298.5

Statistics & Data Analysis

Fight Length
trapping_app Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
trapping_app Damage Per Second
Count 1323
Mean 7257.24
Minimum 6628.79
Maximum 8018.21
Spread ( max - min ) 1389.42
Range [ ( max - min ) / 2 * 100% ] 9.57%
Standard Deviation 217.5927
5th Percentile 6908.78
95th Percentile 7624.71
( 95th Percentile - 5th Percentile ) 715.92
Mean Distribution
Standard Deviation 5.9822
95.00% Confidence Interval ( 7245.52 - 7268.97 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3454
0.1 Scale Factor Error with Delta=300 405
0.05 Scale Factor Error with Delta=300 1617
0.01 Scale Factor Error with Delta=300 40418
Priority Target DPS
trapping_app Priority Target Damage Per Second
Count 1323
Mean 3710.19
Minimum 3368.34
Maximum 4189.21
Spread ( max - min ) 820.87
Range [ ( max - min ) / 2 * 100% ] 11.06%
Standard Deviation 125.8503
5th Percentile 3511.12
95th Percentile 3924.01
( 95th Percentile - 5th Percentile ) 412.89
Mean Distribution
Standard Deviation 3.4600
95.00% Confidence Interval ( 3703.41 - 3716.98 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4420
0.1 Scale Factor Error with Delta=300 136
0.05 Scale Factor Error with Delta=300 541
0.01 Scale Factor Error with Delta=300 13521
DPS(e)
trapping_app Damage Per Second (Effective)
Count 1323
Mean 7257.24
Minimum 6628.79
Maximum 8018.21
Spread ( max - min ) 1389.42
Range [ ( max - min ) / 2 * 100% ] 9.57%
Damage
trapping_app Damage
Count 1323
Mean 2180194.09
Minimum 1667257.42
Maximum 2611205.43
Spread ( max - min ) 943948.00
Range [ ( max - min ) / 2 * 100% ] 21.65%
DTPS
trapping_app Damage Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
trapping_app Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
trapping_app Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
trapping_app Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
trapping_app Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
trapping_app Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
trapping_appTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
trapping_app Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.76 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.48 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.34 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.63 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 48.01 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 16.45 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 74.39 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 4.57 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 7.41 multishot,if=focus>cost+action.aimed_shot.cost
O 50.56 steady_shot

Sample Sequence

0125789FHIDELJLJLKLJLOFJLJOLKLJLOJOFLJLJLKLOJLOFJLOONJLOLGJLKLOFJLOJLOOOLOJLKLOFJLOLO9NNJLOFKLJLOONOGJLOLOFKHIDLJLJLKLJOFLJLKLJLOFJLOJLKLJOFLJLOJLGOFJLKL9OOJLOLONJLOFLJLKLJOFLOJLOOLOJLJLKLOFGJLJLOLOFHIDJLJLKLJLOFJLJLJLJOFL9KLJLMOOJLOOMOLJGLKLJMOFLOLJLMEOOJLKLMOOJLOOMOJLO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask trapping_app 100.0/100: 100% focus
Pre precombat 1 augmentation trapping_app 100.0/100: 100% focus
Pre precombat 2 food trapping_app 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.482 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.397 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.397 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.397 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.397 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.313 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.229 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.144 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.059 trickshots L multishot Fluffy_Pillow 34.5/100: 35% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.974 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:08.325 trickshots L multishot Fluffy_Pillow 52.5/100: 52% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:09.242 trickshots J aimed_shot Fluffy_Pillow 43.8/100: 44% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.158 trickshots L multishot Fluffy_Pillow 20.1/100: 20% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.074 trickshots O steady_shot Fluffy_Pillow 11.4/100: 11% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.142 trickshots F steady_shot Fluffy_Pillow 39.6/100: 40% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:13.210 trickshots J aimed_shot Fluffy_Pillow 67.8/100: 68% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.127 trickshots L multishot Fluffy_Pillow 44.1/100: 44% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:15.041 trickshots J aimed_shot Fluffy_Pillow 35.4/100: 35% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:15.956 trickshots O steady_shot Fluffy_Pillow 11.7/100: 12% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:17.023 trickshots L multishot Fluffy_Pillow 39.8/100: 40% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:17.940 trickshots K rapid_fire Fluffy_Pillow 31.2/100: 31% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:19.367 trickshots L multishot Fluffy_Pillow 58.8/100: 59% focus bloodlust, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:20.283 trickshots J aimed_shot Fluffy_Pillow 50.1/100: 50% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:21.197 trickshots L multishot Fluffy_Pillow 26.4/100: 26% focus bloodlust, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:22.111 trickshots O steady_shot Fluffy_Pillow 17.4/100: 17% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:23.178 trickshots J aimed_shot Fluffy_Pillow 36.2/100: 36% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:24.702 trickshots O steady_shot Fluffy_Pillow 13.7/100: 14% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:25.770 trickshots F steady_shot Fluffy_Pillow 32.5/100: 32% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:26.837 trickshots L multishot Fluffy_Pillow 51.3/100: 51% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:27.753 trickshots J aimed_shot Fluffy_Pillow 38.8/100: 39% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:28.668 trickshots L multishot Fluffy_Pillow 46.3/100: 46% focus bloodlust, precise_shots(2), steady_focus
0:29.584 trickshots J aimed_shot Fluffy_Pillow 33.9/100: 34% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:30.500 trickshots L multishot Fluffy_Pillow 41.4/100: 41% focus bloodlust, precise_shots(2), steady_focus
0:31.415 trickshots K rapid_fire Fluffy_Pillow 28.9/100: 29% focus bloodlust, precise_shots, steady_focus, trick_shots
0:32.764 trickshots L multishot Fluffy_Pillow 47.0/100: 47% focus bloodlust, precise_shots, steady_focus
0:33.679 trickshots O steady_shot Fluffy_Pillow 34.6/100: 35% focus bloodlust, steady_focus, trick_shots
0:34.747 trickshots J aimed_shot Fluffy_Pillow 53.3/100: 53% focus bloodlust, steady_focus, trick_shots
0:36.272 trickshots L multishot Fluffy_Pillow 30.9/100: 31% focus bloodlust, precise_shots, steady_focus
0:37.186 trickshots O steady_shot Fluffy_Pillow 18.4/100: 18% focus bloodlust, steady_focus, trick_shots
0:38.253 trickshots F steady_shot Fluffy_Pillow 37.2/100: 37% focus bloodlust, steady_focus, trick_shots
0:39.319 trickshots J aimed_shot Fluffy_Pillow 56.0/100: 56% focus bloodlust, steady_focus, trick_shots
0:40.841 trickshots L multishot Fluffy_Pillow 33.5/100: 33% focus bloodlust, precise_shots, steady_focus
0:41.757 trickshots O steady_shot Fluffy_Pillow 19.6/100: 20% focus steady_focus, trick_shots
0:43.142 trickshots O steady_shot Fluffy_Pillow 38.3/100: 38% focus steady_focus, trick_shots
0:44.529 trickshots N multishot Fluffy_Pillow 57.1/100: 57% focus steady_focus, trick_shots
0:45.717 trickshots J aimed_shot Fluffy_Pillow 44.6/100: 45% focus lock_and_load, steady_focus, trick_shots
0:46.906 trickshots L multishot Fluffy_Pillow 52.2/100: 52% focus precise_shots(2), steady_focus
0:48.094 trickshots O steady_shot Fluffy_Pillow 39.7/100: 40% focus precise_shots, steady_focus, trick_shots
0:49.481 trickshots L multishot Fluffy_Pillow 58.5/100: 58% focus precise_shots, steady_focus, trick_shots
0:50.669 trickshots G double_tap Fluffy_Pillow 46.0/100: 46% focus steady_focus, trick_shots
0:51.858 trickshots J aimed_shot Fluffy_Pillow 53.5/100: 54% focus double_tap, steady_focus, trick_shots
0:53.837 trickshots L multishot Fluffy_Pillow 31.0/100: 31% focus precise_shots(2), steady_focus
0:55.024 trickshots K rapid_fire Fluffy_Pillow 18.6/100: 19% focus precise_shots, steady_focus, trick_shots
0:56.762 trickshots L multishot Fluffy_Pillow 36.6/100: 37% focus precise_shots, steady_focus
0:57.951 trickshots O steady_shot Fluffy_Pillow 24.1/100: 24% focus steady_focus, trick_shots
0:59.337 trickshots F steady_shot Fluffy_Pillow 42.9/100: 43% focus steady_focus, trick_shots
1:00.722 trickshots J aimed_shot Fluffy_Pillow 61.1/100: 61% focus steady_focus, trick_shots
1:02.701 trickshots L multishot Fluffy_Pillow 38.6/100: 39% focus precise_shots, steady_focus
1:03.889 trickshots O steady_shot Fluffy_Pillow 26.2/100: 26% focus steady_focus, trick_shots
1:05.274 trickshots J aimed_shot Fluffy_Pillow 44.9/100: 45% focus steady_focus, trick_shots
1:07.253 trickshots L multishot Fluffy_Pillow 22.5/100: 22% focus precise_shots(2), steady_focus
1:08.440 trickshots O steady_shot Fluffy_Pillow 10.0/100: 10% focus precise_shots, steady_focus, trick_shots
1:09.826 trickshots O steady_shot Fluffy_Pillow 28.7/100: 29% focus precise_shots, steady_focus, trick_shots
1:11.213 trickshots O steady_shot Fluffy_Pillow 47.5/100: 48% focus precise_shots, steady_focus, trick_shots
1:12.600 trickshots L multishot Fluffy_Pillow 66.3/100: 66% focus precise_shots, steady_focus, trick_shots
1:13.789 trickshots O steady_shot Fluffy_Pillow 53.8/100: 54% focus steady_focus, trick_shots
1:15.175 trickshots J aimed_shot Fluffy_Pillow 72.6/100: 73% focus steady_focus, trick_shots
1:17.155 trickshots L multishot Fluffy_Pillow 50.1/100: 50% focus precise_shots(2), steady_focus
1:18.344 trickshots K rapid_fire Fluffy_Pillow 37.7/100: 38% focus precise_shots, steady_focus, trick_shots
1:20.148 trickshots L multishot Fluffy_Pillow 56.1/100: 56% focus precise_shots, steady_focus
1:21.337 trickshots O steady_shot Fluffy_Pillow 43.6/100: 44% focus steady_focus, trick_shots
1:22.725 trickshots F steady_shot Fluffy_Pillow 62.4/100: 62% focus steady_focus, trick_shots
1:24.112 trickshots J aimed_shot Fluffy_Pillow 81.2/100: 81% focus steady_focus, trick_shots
1:26.090 trickshots L multishot Fluffy_Pillow 58.7/100: 59% focus precise_shots(2), steady_focus
1:27.279 trickshots O steady_shot Fluffy_Pillow 46.2/100: 46% focus precise_shots, steady_focus, trick_shots
1:28.666 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus, trick_shots
1:29.854 trickshots O steady_shot Fluffy_Pillow 52.5/100: 53% focus steady_focus, trick_shots
1:31.241 default 9 use_items Fluffy_Pillow 71.3/100: 71% focus steady_focus, trick_shots
1:31.241 trickshots N multishot Fluffy_Pillow 71.3/100: 71% focus steady_focus, trick_shots
1:32.429 trickshots N multishot Fluffy_Pillow 58.8/100: 59% focus steady_focus, trick_shots
1:33.618 trickshots J aimed_shot Fluffy_Pillow 46.3/100: 46% focus steady_focus, trick_shots
1:35.596 trickshots L multishot Fluffy_Pillow 23.8/100: 24% focus precise_shots, steady_focus
1:36.784 trickshots O steady_shot Fluffy_Pillow 11.4/100: 11% focus steady_focus, trick_shots
1:38.170 trickshots F steady_shot Fluffy_Pillow 30.1/100: 30% focus steady_focus, trick_shots
1:39.557 trickshots K rapid_fire Fluffy_Pillow 48.7/100: 49% focus steady_focus, trick_shots
1:41.431 trickshots L multishot Fluffy_Pillow 67.6/100: 68% focus steady_focus
1:42.619 trickshots J aimed_shot Fluffy_Pillow 55.1/100: 55% focus steady_focus, trick_shots
1:44.674 trickshots L multishot Fluffy_Pillow 33.1/100: 33% focus precise_shots, steady_focus
1:45.862 trickshots O steady_shot Fluffy_Pillow 20.6/100: 21% focus steady_focus, trick_shots
1:47.249 trickshots O steady_shot Fluffy_Pillow 39.4/100: 39% focus steady_focus, trick_shots
1:48.636 trickshots N multishot Fluffy_Pillow 58.2/100: 58% focus steady_focus, trick_shots
1:49.825 trickshots O steady_shot Fluffy_Pillow 45.7/100: 46% focus steady_focus, trick_shots
1:51.211 trickshots G double_tap Fluffy_Pillow 64.5/100: 64% focus steady_focus, trick_shots
1:52.401 trickshots J aimed_shot Fluffy_Pillow 72.0/100: 72% focus double_tap, steady_focus, trick_shots
1:54.380 trickshots L multishot Fluffy_Pillow 49.6/100: 50% focus precise_shots(2), steady_focus
1:55.568 trickshots O steady_shot Fluffy_Pillow 37.1/100: 37% focus precise_shots, steady_focus, trick_shots
1:56.954 trickshots L multishot Fluffy_Pillow 55.8/100: 56% focus precise_shots, steady_focus, trick_shots
1:58.142 trickshots O steady_shot Fluffy_Pillow 43.4/100: 43% focus steady_focus, trick_shots
1:59.527 trickshots F steady_shot Fluffy_Pillow 62.1/100: 62% focus steady_focus, trick_shots
2:00.914 trickshots K rapid_fire Fluffy_Pillow 80.9/100: 81% focus steady_focus, trick_shots
2:02.752 trickshots H wild_spirits Fluffy_Pillow 99.5/100: 100% focus steady_focus
2:03.941 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus steady_focus
2:03.941 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus steady_focus, trueshot
2:03.941 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus blood_fury, steady_focus, trueshot
2:05.129 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:06.317 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:07.506 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:08.694 trickshots L multishot Fluffy_Pillow 34.5/100: 34% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:09.883 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:11.565 trickshots L multishot Fluffy_Pillow 51.7/100: 52% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:12.753 trickshots J aimed_shot Fluffy_Pillow 43.0/100: 43% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:13.941 trickshots O steady_shot Fluffy_Pillow 19.3/100: 19% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:15.328 trickshots F steady_shot Fluffy_Pillow 47.5/100: 47% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:16.712 trickshots L multishot Fluffy_Pillow 75.1/100: 75% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:17.900 trickshots J aimed_shot Fluffy_Pillow 66.4/100: 66% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:19.089 trickshots L multishot Fluffy_Pillow 42.7/100: 43% focus precise_shots(2), steady_focus, trueshot, wild_spirits
2:20.276 trickshots K rapid_fire Fluffy_Pillow 33.9/100: 34% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:22.044 trickshots L multishot Fluffy_Pillow 60.7/100: 61% focus precise_shots, steady_focus, trueshot, wild_spirits
2:23.233 trickshots J aimed_shot Fluffy_Pillow 52.0/100: 52% focus steady_focus, trick_shots, trueshot
2:24.423 trickshots L multishot Fluffy_Pillow 25.7/100: 26% focus precise_shots, steady_focus
2:25.610 trickshots O steady_shot Fluffy_Pillow 13.2/100: 13% focus steady_focus, trick_shots
2:26.996 trickshots F steady_shot Fluffy_Pillow 32.0/100: 32% focus steady_focus, trick_shots
2:28.383 trickshots J aimed_shot Fluffy_Pillow 50.7/100: 51% focus steady_focus, trick_shots
2:30.360 trickshots L multishot Fluffy_Pillow 28.2/100: 28% focus precise_shots(2), steady_focus
2:31.549 trickshots O steady_shot Fluffy_Pillow 15.8/100: 16% focus precise_shots, steady_focus, trick_shots
2:32.935 trickshots J aimed_shot Fluffy_Pillow 34.5/100: 35% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:34.123 trickshots L multishot Fluffy_Pillow 42.1/100: 42% focus precise_shots(2), steady_focus
2:35.312 trickshots K rapid_fire Fluffy_Pillow 29.6/100: 30% focus precise_shots, steady_focus, trick_shots
2:37.201 trickshots L multishot Fluffy_Pillow 48.5/100: 49% focus precise_shots, steady_focus
2:38.390 trickshots J aimed_shot Fluffy_Pillow 36.1/100: 36% focus steady_focus, trick_shots
2:40.368 trickshots O steady_shot Fluffy_Pillow 13.6/100: 14% focus precise_shots, steady_focus
2:41.756 trickshots F steady_shot Fluffy_Pillow 32.4/100: 32% focus precise_shots, steady_focus
2:43.144 trickshots L multishot Fluffy_Pillow 51.2/100: 51% focus lock_and_load, precise_shots, steady_focus
2:44.332 trickshots J aimed_shot Fluffy_Pillow 38.7/100: 39% focus lock_and_load, steady_focus, trick_shots
2:45.522 trickshots L multishot Fluffy_Pillow 46.2/100: 46% focus precise_shots, steady_focus
2:46.711 trickshots O steady_shot Fluffy_Pillow 33.7/100: 34% focus steady_focus, trick_shots
2:48.098 trickshots J aimed_shot Fluffy_Pillow 52.5/100: 53% focus steady_focus, trick_shots
2:50.076 trickshots L multishot Fluffy_Pillow 30.0/100: 30% focus precise_shots, steady_focus
2:51.264 trickshots G double_tap Fluffy_Pillow 17.6/100: 18% focus steady_focus, trick_shots
2:52.454 trickshots O steady_shot Fluffy_Pillow 25.1/100: 25% focus double_tap, steady_focus, trick_shots
2:53.841 trickshots F steady_shot Fluffy_Pillow 43.9/100: 44% focus double_tap, steady_focus, trick_shots
2:55.227 trickshots J aimed_shot Fluffy_Pillow 62.6/100: 63% focus double_tap, steady_focus, trick_shots
2:57.207 trickshots L multishot Fluffy_Pillow 40.2/100: 40% focus precise_shots(2), steady_focus
2:58.394 trickshots K rapid_fire Fluffy_Pillow 27.7/100: 28% focus precise_shots, steady_focus, trick_shots
3:00.254 trickshots L multishot Fluffy_Pillow 46.5/100: 46% focus precise_shots, steady_focus
3:01.443 default 9 use_items Fluffy_Pillow 34.0/100: 34% focus steady_focus, trick_shots
3:01.443 trickshots O steady_shot Fluffy_Pillow 34.0/100: 34% focus steady_focus, trick_shots
3:02.831 trickshots O steady_shot Fluffy_Pillow 52.8/100: 53% focus steady_focus, trick_shots
3:04.217 trickshots J aimed_shot Fluffy_Pillow 71.5/100: 72% focus steady_focus, trick_shots
3:06.196 trickshots L multishot Fluffy_Pillow 49.1/100: 49% focus precise_shots(2), steady_focus
3:07.383 trickshots O steady_shot Fluffy_Pillow 36.6/100: 37% focus precise_shots, steady_focus, trick_shots
3:08.769 trickshots L multishot Fluffy_Pillow 55.3/100: 55% focus precise_shots, steady_focus, trick_shots
3:09.958 trickshots O steady_shot Fluffy_Pillow 42.9/100: 43% focus steady_focus, trick_shots
3:11.345 trickshots N multishot Fluffy_Pillow 61.7/100: 62% focus steady_focus, trick_shots
3:12.535 trickshots J aimed_shot Fluffy_Pillow 49.2/100: 49% focus lock_and_load, steady_focus, trick_shots
3:13.723 trickshots L multishot Fluffy_Pillow 56.7/100: 57% focus precise_shots(2), steady_focus
3:14.911 trickshots O steady_shot Fluffy_Pillow 44.2/100: 44% focus precise_shots, steady_focus, trick_shots
3:16.297 trickshots F steady_shot Fluffy_Pillow 63.0/100: 63% focus precise_shots, steady_focus, trick_shots
3:17.684 trickshots L multishot Fluffy_Pillow 81.8/100: 82% focus precise_shots, steady_focus, trick_shots
3:18.872 trickshots J aimed_shot Fluffy_Pillow 69.3/100: 69% focus steady_focus, trick_shots
3:20.850 trickshots L multishot Fluffy_Pillow 46.8/100: 47% focus precise_shots, steady_focus
3:22.038 trickshots K rapid_fire Fluffy_Pillow 34.3/100: 34% focus steady_focus, trick_shots
3:23.905 trickshots L multishot Fluffy_Pillow 53.1/100: 53% focus steady_focus
3:25.095 trickshots J aimed_shot Fluffy_Pillow 40.7/100: 41% focus steady_focus, trick_shots
3:27.075 trickshots O steady_shot Fluffy_Pillow 18.2/100: 18% focus precise_shots, steady_focus
3:28.461 trickshots F steady_shot Fluffy_Pillow 37.0/100: 37% focus precise_shots, steady_focus
3:29.848 trickshots L multishot Fluffy_Pillow 55.8/100: 56% focus precise_shots, steady_focus
3:31.036 trickshots O steady_shot Fluffy_Pillow 43.3/100: 43% focus steady_focus, trick_shots
3:32.423 trickshots J aimed_shot Fluffy_Pillow 62.1/100: 62% focus steady_focus, trick_shots
3:34.400 trickshots L multishot Fluffy_Pillow 39.6/100: 40% focus precise_shots(2), steady_focus
3:35.589 trickshots O steady_shot Fluffy_Pillow 27.1/100: 27% focus precise_shots, steady_focus, trick_shots
3:36.975 trickshots O steady_shot Fluffy_Pillow 45.9/100: 46% focus precise_shots, steady_focus, trick_shots
3:38.361 trickshots L multishot Fluffy_Pillow 64.6/100: 65% focus precise_shots, steady_focus, trick_shots
3:39.549 trickshots O steady_shot Fluffy_Pillow 52.2/100: 52% focus steady_focus, trick_shots
3:40.934 trickshots J aimed_shot Fluffy_Pillow 70.9/100: 71% focus lock_and_load, steady_focus, trick_shots
3:42.122 trickshots L multishot Fluffy_Pillow 78.4/100: 78% focus precise_shots, steady_focus
3:43.309 trickshots J aimed_shot Fluffy_Pillow 66.0/100: 66% focus steady_focus, trick_shots
3:45.288 trickshots L multishot Fluffy_Pillow 43.5/100: 43% focus precise_shots, steady_focus
3:46.478 trickshots K rapid_fire Fluffy_Pillow 31.0/100: 31% focus steady_focus, trick_shots
3:48.377 trickshots L multishot Fluffy_Pillow 50.0/100: 50% focus steady_focus
3:49.566 trickshots O steady_shot Fluffy_Pillow 37.6/100: 38% focus steady_focus, trick_shots
3:50.953 trickshots F steady_shot Fluffy_Pillow 56.3/100: 56% focus steady_focus, trick_shots
3:52.340 trickshots G double_tap Fluffy_Pillow 75.1/100: 75% focus lock_and_load, steady_focus, trick_shots
3:53.529 trickshots J aimed_shot Fluffy_Pillow 82.6/100: 83% focus double_tap, lock_and_load, steady_focus, trick_shots
3:54.717 trickshots L multishot Fluffy_Pillow 90.2/100: 90% focus precise_shots, steady_focus
3:55.906 trickshots J aimed_shot Fluffy_Pillow 77.7/100: 78% focus steady_focus, trick_shots
3:57.885 trickshots L multishot Fluffy_Pillow 55.2/100: 55% focus precise_shots(2), steady_focus
3:59.073 trickshots O steady_shot Fluffy_Pillow 42.7/100: 43% focus precise_shots, steady_focus, trick_shots
4:00.459 trickshots L multishot Fluffy_Pillow 61.5/100: 62% focus precise_shots, steady_focus, trick_shots
4:01.647 trickshots O steady_shot Fluffy_Pillow 49.0/100: 49% focus steady_focus, trick_shots
4:03.033 trickshots F steady_shot Fluffy_Pillow 67.8/100: 68% focus steady_focus, trick_shots
4:04.419 trickshots H wild_spirits Fluffy_Pillow 86.6/100: 87% focus steady_focus, trick_shots
4:05.608 trickshots I trueshot Fluffy_Pillow 94.1/100: 94% focus steady_focus, trick_shots
4:05.608 cds D blood_fury Fluffy_Pillow 94.1/100: 94% focus steady_focus, trick_shots, trueshot
4:05.608 trickshots J aimed_shot Fluffy_Pillow 94.1/100: 94% focus blood_fury, steady_focus, trick_shots, trueshot
4:06.796 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:07.984 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:09.170 trickshots L multishot Fluffy_Pillow 34.4/100: 34% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:10.357 trickshots K rapid_fire Fluffy_Pillow 25.7/100: 26% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:12.135 trickshots L multishot Fluffy_Pillow 53.6/100: 54% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:13.324 trickshots J aimed_shot Fluffy_Pillow 44.9/100: 45% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:14.512 trickshots L multishot Fluffy_Pillow 21.2/100: 21% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:15.702 trickshots O steady_shot Fluffy_Pillow 12.5/100: 12% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:17.088 trickshots F steady_shot Fluffy_Pillow 40.6/100: 41% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:18.473 trickshots J aimed_shot Fluffy_Pillow 68.8/100: 69% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:19.662 trickshots L multishot Fluffy_Pillow 45.1/100: 45% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:20.850 trickshots J aimed_shot Fluffy_Pillow 36.3/100: 36% focus lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:22.038 trickshots L multishot Fluffy_Pillow 47.6/100: 48% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:23.226 trickshots J aimed_shot Fluffy_Pillow 38.9/100: 39% focus lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:24.414 trickshots L multishot Fluffy_Pillow 50.2/100: 50% focus precise_shots(2), steady_focus, trueshot
4:25.603 trickshots J aimed_shot Fluffy_Pillow 40.4/100: 40% focus precise_shots, steady_focus, trick_shots
4:27.582 trickshots O steady_shot Fluffy_Pillow 17.9/100: 18% focus precise_shots(2), steady_focus
4:28.968 trickshots F steady_shot Fluffy_Pillow 36.7/100: 37% focus precise_shots(2), steady_focus
4:30.354 trickshots L multishot Fluffy_Pillow 55.4/100: 55% focus precise_shots(2), steady_focus
4:31.544 default 9 use_items Fluffy_Pillow 43.0/100: 43% focus precise_shots, steady_focus, trick_shots
4:31.544 trickshots K rapid_fire Fluffy_Pillow 43.0/100: 43% focus precise_shots, steady_focus, trick_shots
4:33.308 trickshots L multishot Fluffy_Pillow 61.1/100: 61% focus precise_shots, steady_focus
4:34.496 trickshots J aimed_shot Fluffy_Pillow 48.7/100: 49% focus steady_focus, trick_shots
4:36.476 trickshots L multishot Fluffy_Pillow 26.2/100: 26% focus precise_shots, steady_focus
4:37.663 trickshots M kill_shot Fluffy_Pillow 13.7/100: 14% focus steady_focus, trick_shots
4:38.852 trickshots O steady_shot Fluffy_Pillow 11.2/100: 11% focus steady_focus, trick_shots
4:40.238 trickshots O steady_shot Fluffy_Pillow 30.0/100: 30% focus steady_focus, trick_shots
4:41.623 trickshots J aimed_shot Fluffy_Pillow 48.8/100: 49% focus steady_focus, trick_shots
4:43.600 trickshots L multishot Fluffy_Pillow 26.3/100: 26% focus precise_shots(2), steady_focus
4:44.788 trickshots O steady_shot Fluffy_Pillow 13.8/100: 14% focus precise_shots, steady_focus, trick_shots
4:46.174 trickshots O steady_shot Fluffy_Pillow 32.6/100: 33% focus precise_shots, steady_focus, trick_shots
4:47.560 trickshots M kill_shot Fluffy_Pillow 51.3/100: 51% focus precise_shots, steady_focus, trick_shots
4:48.849 trickshots O steady_shot Fluffy_Pillow 49.5/100: 49% focus precise_shots, steady_focus, trick_shots
4:50.232 trickshots L multishot Fluffy_Pillow 68.2/100: 68% focus precise_shots, steady_focus, trick_shots
4:51.421 trickshots J aimed_shot Fluffy_Pillow 55.8/100: 56% focus steady_focus, trick_shots
4:53.399 trickshots G double_tap Fluffy_Pillow 33.3/100: 33% focus precise_shots, steady_focus
4:54.589 trickshots L multishot Fluffy_Pillow 40.8/100: 41% focus double_tap, precise_shots, steady_focus
4:55.778 trickshots K rapid_fire Fluffy_Pillow 28.4/100: 28% focus double_tap, steady_focus, trick_shots
4:57.678 trickshots L multishot Fluffy_Pillow 54.4/100: 54% focus steady_focus
4:58.867 trickshots J aimed_shot Fluffy_Pillow 41.9/100: 42% focus steady_focus, trick_shots
5:00.846 trickshots M kill_shot Fluffy_Pillow 19.4/100: 19% focus precise_shots(2), steady_focus
5:02.035 trickshots O steady_shot Fluffy_Pillow 17.0/100: 17% focus precise_shots(2), steady_focus
5:03.421 trickshots F steady_shot Fluffy_Pillow 35.4/100: 35% focus precise_shots(2)
5:04.904 trickshots L multishot Fluffy_Pillow 54.1/100: 54% focus precise_shots(2), steady_focus
5:06.094 trickshots O steady_shot Fluffy_Pillow 41.7/100: 42% focus precise_shots, steady_focus, trick_shots
5:07.480 trickshots L multishot Fluffy_Pillow 60.4/100: 60% focus precise_shots, steady_focus, trick_shots
5:08.667 trickshots J aimed_shot Fluffy_Pillow 48.0/100: 48% focus steady_focus, trick_shots
5:10.646 trickshots L multishot Fluffy_Pillow 25.5/100: 25% focus precise_shots, steady_focus
5:11.832 trickshots M kill_shot Fluffy_Pillow 13.0/100: 13% focus steady_focus, trick_shots
5:13.022 cds E potion Fluffy_Pillow 10.5/100: 11% focus steady_focus, trick_shots
5:13.022 trickshots O steady_shot Fluffy_Pillow 10.5/100: 11% focus steady_focus, trick_shots, potion_of_spectral_agility
5:14.410 trickshots O steady_shot Fluffy_Pillow 29.3/100: 29% focus steady_focus, trick_shots, potion_of_spectral_agility
5:15.795 trickshots J aimed_shot Fluffy_Pillow 48.1/100: 48% focus steady_focus, trick_shots, potion_of_spectral_agility
5:17.775 trickshots L multishot Fluffy_Pillow 25.6/100: 26% focus precise_shots, steady_focus, potion_of_spectral_agility
5:18.962 trickshots K rapid_fire Fluffy_Pillow 13.1/100: 13% focus steady_focus, trick_shots, potion_of_spectral_agility
5:20.752 trickshots L multishot Fluffy_Pillow 31.4/100: 31% focus steady_focus, potion_of_spectral_agility
5:21.941 trickshots M kill_shot Fluffy_Pillow 19.0/100: 19% focus steady_focus, trick_shots, potion_of_spectral_agility
5:23.129 trickshots O steady_shot Fluffy_Pillow 16.5/100: 16% focus steady_focus, trick_shots, potion_of_spectral_agility
5:24.516 trickshots O steady_shot Fluffy_Pillow 35.3/100: 35% focus steady_focus, trick_shots, potion_of_spectral_agility
5:25.902 trickshots J aimed_shot Fluffy_Pillow 54.0/100: 54% focus steady_focus, trick_shots, potion_of_spectral_agility
5:27.879 trickshots L multishot Fluffy_Pillow 31.6/100: 32% focus precise_shots, steady_focus, potion_of_spectral_agility
5:29.067 trickshots O steady_shot Fluffy_Pillow 19.1/100: 19% focus steady_focus, trick_shots, potion_of_spectral_agility
5:30.454 trickshots O steady_shot Fluffy_Pillow 37.9/100: 38% focus steady_focus, trick_shots, potion_of_spectral_agility
5:31.841 trickshots M kill_shot Fluffy_Pillow 56.6/100: 57% focus steady_focus, trick_shots, potion_of_spectral_agility
5:33.128 trickshots O steady_shot Fluffy_Pillow 54.8/100: 55% focus steady_focus, trick_shots, potion_of_spectral_agility
5:34.516 trickshots J aimed_shot Fluffy_Pillow 73.6/100: 74% focus steady_focus, trick_shots, potion_of_spectral_agility
5:36.615 trickshots L multishot Fluffy_Pillow 51.8/100: 52% focus precise_shots, steady_focus, potion_of_spectral_agility
5:37.804 trickshots O steady_shot Fluffy_Pillow 39.4/100: 39% focus steady_focus, trick_shots, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Nesingwary's Trapping Apparatus }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="trapping_app"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7004,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

Simulation & Raid Information

Iterations: 1339
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.9 )

Performance:

Total Events Processed: 35001138
Max Event Queue: 392
Sim Seconds: 402947
CPU Seconds: 40.9688
Physical Seconds: 7.1485
Speed Up: 9835

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
call_ot_wild call_ot_wild aimed_shot 19434 777569 2584 30.09 4196 8398 50.4 150.9 22.8% 0.0% 0.0% 0.0% 5.94sec 1110680 300.93sec
call_ot_wild call_ot_wild aimed_shot_double_tap 19434 76315 254 2.86 4315 8624 0.0 14.4 23.2% 0.0% 0.0% 0.0% 0.00sec 109008 300.93sec
call_ot_wild call_ot_wild augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
call_ot_wild call_ot_wild auto_shot 75 111125 369 22.30 811 1621 112.1 111.8 22.6% 0.0% 0.0% 0.0% 2.69sec 158730 300.93sec
call_ot_wild call_ot_wild blood_fury 20572 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 151.30sec 0 300.93sec
call_ot_wild call_ot_wild double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.64sec 0 300.93sec
call_ot_wild call_ot_wild dreadfire_vessel 344732 41384 138 0.75 9016 18035 3.8 3.7 22.7% 0.0% 0.0% 0.0% 90.75sec 41384 300.93sec
call_ot_wild call_ot_wild eternal_skirmish 323889 12019 40 4.39 446 892 22.0 22.0 22.5% 0.0% 0.0% 0.0% 13.16sec 12019 300.93sec
call_ot_wild call_ot_wild flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
call_ot_wild call_ot_wild food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
call_ot_wild call_ot_wild kill_shot 53351 24310 81 0.88 4259 9600 4.5 4.4 22.9% 0.0% 0.0% 0.0% 13.78sec 34724 300.93sec
call_ot_wild call_ot_wild master_marksman ticks -269576 100171 334 65.14 308 0 195.3 325.7 0.0% 0.0% 0.0% 0.0% 1.54sec 100171 300.93sec
call_ot_wild call_ot_wild multishot 257620 492984 1638 48.63 1647 3289 81.5 243.9 22.8% 0.0% 0.0% 0.0% 3.69sec 704178 300.93sec
call_ot_wild call_ot_wild potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.31sec 0 300.93sec
call_ot_wild call_ot_wild rapid_fire ticks -257044 230130 767 25.48 493 985 17.5 127.4 22.7% 0.0% 0.0% 0.0% 17.24sec 328717 300.93sec
call_ot_wild call_ot_wild shadowcore_oil_blast 336463 13086 43 8.67 245 491 43.5 43.5 22.6% 0.0% 0.0% 0.0% 6.84sec 13086 300.93sec
call_ot_wild call_ot_wild steady_shot 56641 101521 337 13.03 1266 2534 64.5 65.4 22.7% 0.0% 0.0% 0.0% 4.63sec 145012 300.93sec
call_ot_wild call_ot_wild trueshot 288613 0 0 0.00 0 0 4.4 0.0 0.0% 0.0% 0.0% 0.0% 78.63sec 0 300.93sec
call_ot_wild call_ot_wild wild_spirits 328231 8512 28 1.78 776 1555 3.0 8.9 22.9% 0.0% 0.0% 0.0% 120.57sec 8512 300.93sec
call_ot_wild call_ot_wild wild_spirits_proc 328757 227353 755 25.17 1467 2932 42.1 126.2 22.8% 0.0% 0.0% 0.0% 6.11sec 227353 300.93sec
eagle_true_focus eagle_true_focus aimed_shot 19434 841857 2798 31.93 4286 8560 53.5 160.2 22.7% 0.0% 0.0% 0.0% 5.59sec 1202508 300.93sec
eagle_true_focus eagle_true_focus aimed_shot_double_tap 19434 78914 262 2.98 4325 8564 0.0 14.9 22.7% 0.0% 0.0% 0.0% 0.00sec 112721 300.93sec
eagle_true_focus eagle_true_focus augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
eagle_true_focus eagle_true_focus auto_shot 75 111969 372 22.45 811 1622 112.8 112.6 22.6% 0.0% 0.0% 0.0% 2.67sec 159936 300.93sec
eagle_true_focus eagle_true_focus blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.70sec 0 300.93sec
eagle_true_focus eagle_true_focus double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.64sec 0 300.93sec
eagle_true_focus eagle_true_focus dreadfire_vessel 344732 41643 138 0.75 9039 18070 3.8 3.7 23.2% 0.0% 0.0% 0.0% 90.79sec 41643 300.93sec
eagle_true_focus eagle_true_focus eternal_skirmish 323889 11883 39 4.34 446 892 21.8 21.8 22.5% 0.0% 0.0% 0.0% 13.26sec 11883 300.93sec
eagle_true_focus eagle_true_focus flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
eagle_true_focus eagle_true_focus food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
eagle_true_focus eagle_true_focus kill_shot 53351 21562 72 0.79 4211 9492 4.0 4.0 23.3% 0.0% 0.0% 0.0% 14.26sec 30799 300.93sec
eagle_true_focus eagle_true_focus master_marksman ticks -269576 103328 344 64.63 320 0 188.0 323.1 0.0% 0.0% 0.0% 0.0% 1.60sec 103328 300.93sec
eagle_true_focus eagle_true_focus multishot 257620 536260 1782 53.72 1624 3245 90.0 269.4 22.6% 0.0% 0.0% 0.0% 3.33sec 765993 300.93sec
eagle_true_focus eagle_true_focus potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.91sec 0 300.93sec
eagle_true_focus eagle_true_focus rapid_fire ticks -257044 195881 653 21.74 491 984 15.0 108.7 22.7% 0.0% 0.0% 0.0% 19.63sec 279796 300.93sec
eagle_true_focus eagle_true_focus shadowcore_oil_blast 336463 13023 43 8.63 245 491 43.3 43.3 22.6% 0.0% 0.0% 0.0% 6.89sec 13023 300.93sec
eagle_true_focus eagle_true_focus steady_shot 56641 85380 284 11.18 1243 2485 55.2 56.1 22.5% 0.0% 0.0% 0.0% 5.39sec 121957 300.93sec
eagle_true_focus eagle_true_focus trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.71sec 0 300.93sec
eagle_true_focus eagle_true_focus wild_spirits 328231 8845 29 1.78 810 1619 3.0 8.9 22.5% 0.0% 0.0% 0.0% 120.57sec 8845 300.93sec
eagle_true_focus eagle_true_focus wild_spirits_proc 328757 252459 839 27.18 1510 3020 45.4 136.3 22.6% 0.0% 0.0% 0.0% 5.66sec 252459 300.93sec
marksmanship marksmanship aimed_shot 19434 710700 2362 27.92 4143 8261 46.7 140.0 22.6% 0.0% 0.0% 0.0% 6.40sec 1015164 300.93sec
marksmanship marksmanship aimed_shot_double_tap 19434 80619 268 3.08 4212 8568 0.0 15.5 23.0% 0.0% 0.0% 0.0% 0.00sec 115156 300.93sec
marksmanship marksmanship augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
marksmanship marksmanship auto_shot 75 112156 373 22.66 805 1609 113.9 113.7 22.6% 0.0% 0.0% 0.0% 2.65sec 160203 300.93sec
marksmanship marksmanship blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.59sec 0 300.93sec
marksmanship marksmanship double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.62sec 0 300.93sec
marksmanship marksmanship dreadfire_vessel 344732 41880 139 0.75 9041 18093 3.8 3.7 23.8% 0.0% 0.0% 0.0% 90.73sec 41880 300.93sec
marksmanship marksmanship eternal_skirmish 323889 12013 40 4.40 442 884 22.1 22.1 23.1% 0.0% 0.0% 0.0% 13.17sec 12013 300.93sec
marksmanship marksmanship flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
marksmanship marksmanship food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
marksmanship marksmanship kill_shot 53351 25204 84 0.93 4224 9516 4.7 4.6 22.7% 0.0% 0.0% 0.0% 13.19sec 36002 300.93sec
marksmanship marksmanship master_marksman ticks -269576 95293 318 65.92 289 0 196.7 329.6 0.0% 0.0% 0.0% 0.0% 1.54sec 95293 300.93sec
marksmanship marksmanship multishot 257620 482265 1603 49.11 1595 3188 82.3 246.3 22.8% 0.0% 0.0% 0.0% 3.66sec 688868 300.93sec
marksmanship marksmanship potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 309.26sec 0 300.93sec
marksmanship marksmanship rapid_fire ticks -257044 206472 688 23.00 490 979 16.1 115.0 22.6% 0.0% 0.0% 0.0% 18.84sec 294925 300.93sec
marksmanship marksmanship serpent_sting 271788 28670 95 9.29 501 1001 0.0 46.6 22.8% 0.0% 0.0% 0.0% 0.00sec 236747 300.93sec
marksmanship marksmanship serpent_sting ticks -271788 208078 694 70.44 481 963 0.0 352.2 22.7% 0.0% 0.0% 0.0% 0.00sec 236747 300.93sec
marksmanship marksmanship shadowcore_oil_blast 336463 13134 44 8.81 243 485 44.2 44.2 22.5% 0.0% 0.0% 0.0% 6.71sec 13134 300.93sec
marksmanship marksmanship steady_shot 56641 108025 359 13.96 1257 2514 69.1 70.0 22.7% 0.0% 0.0% 0.0% 4.34sec 154303 300.93sec
marksmanship marksmanship trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.60sec 0 300.93sec
no_lego no_lego aimed_shot 19434 740594 2461 28.54 4220 8428 47.8 143.1 22.7% 0.0% 0.0% 0.0% 6.26sec 1057864 300.93sec
no_lego no_lego aimed_shot_double_tap 19434 73135 243 2.76 4332 8638 0.0 13.8 22.3% 0.0% 0.0% 0.0% 0.00sec 104466 300.93sec
no_lego no_lego augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
no_lego no_lego auto_shot 75 112344 373 22.49 812 1624 113.0 112.8 22.7% 0.0% 0.0% 0.0% 2.67sec 160472 300.93sec
no_lego no_lego blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.75sec 0 300.93sec
no_lego no_lego double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.62sec 0 300.93sec
no_lego no_lego dreadfire_vessel 344732 41387 138 0.75 9058 18099 3.8 3.7 22.1% 0.0% 0.0% 0.0% 90.72sec 41387 300.93sec
no_lego no_lego eternal_skirmish 323889 12016 40 4.37 446 893 21.9 21.9 22.9% 0.0% 0.0% 0.0% 13.39sec 12016 300.93sec
no_lego no_lego flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
no_lego no_lego food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
no_lego no_lego kill_shot 53351 24962 83 0.91 4259 9601 4.6 4.6 22.9% 0.0% 0.0% 0.0% 13.67sec 35655 300.93sec
no_lego no_lego master_marksman ticks -269576 96730 322 64.19 301 0 189.3 321.0 0.0% 0.0% 0.0% 0.0% 1.59sec 96730 300.93sec
no_lego no_lego multishot 257620 487639 1620 48.82 1626 3247 81.8 244.9 22.6% 0.0% 0.0% 0.0% 3.66sec 696544 300.93sec
no_lego no_lego potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.90sec 0 300.93sec
no_lego no_lego rapid_fire ticks -257044 219694 732 24.21 495 989 16.4 121.0 22.7% 0.0% 0.0% 0.0% 18.39sec 313811 300.93sec
no_lego no_lego shadowcore_oil_blast 336463 13284 44 8.80 245 491 44.1 44.1 22.7% 0.0% 0.0% 0.0% 6.72sec 13284 300.93sec
no_lego no_lego steady_shot 56641 105023 349 13.48 1266 2533 66.7 67.6 22.7% 0.0% 0.0% 0.0% 4.48sec 150015 300.93sec
no_lego no_lego trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.76sec 0 300.93sec
no_lego no_lego wild_spirits 328231 8797 29 1.78 810 1621 3.0 8.9 21.9% 0.0% 0.0% 0.0% 120.62sec 8797 300.93sec
no_lego no_lego wild_spirits_proc 328757 243657 810 26.24 1509 3018 43.9 131.6 22.7% 0.0% 0.0% 0.0% 5.84sec 243657 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil aimed_shot 19434 918940 3054 35.77 4183 8347 59.9 179.4 22.5% 0.0% 0.0% 0.0% 4.98sec 1312614 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil aimed_shot_double_tap 19434 77350 257 2.93 4300 8617 0.0 14.7 22.4% 0.0% 0.0% 0.0% 0.00sec 110486 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil auto_shot 75 112097 373 22.51 809 1618 113.2 112.9 22.7% 0.0% 0.0% 0.0% 2.66sec 160120 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.80sec 0 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.65sec 0 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil dreadfire_vessel 344732 41255 137 0.75 9034 18051 3.8 3.7 22.2% 0.0% 0.0% 0.0% 90.79sec 41255 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil eternal_skirmish 323889 11899 40 4.33 446 891 21.7 21.7 22.8% 0.0% 0.0% 0.0% 13.40sec 11899 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil kill_shot 53351 21035 70 0.77 4248 9579 3.9 3.9 22.6% 0.0% 0.0% 0.0% 15.79sec 30047 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil master_marksman ticks -269576 106754 356 64.35 332 0 188.3 321.7 0.0% 0.0% 0.0% 0.0% 1.58sec 106754 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil multishot 257620 521825 1734 49.25 1721 3441 82.5 247.0 22.8% 0.0% 0.0% 0.0% 3.63sec 745375 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.94sec 0 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil rapid_fire ticks -257044 203355 678 22.30 496 994 15.3 111.5 22.7% 0.0% 0.0% 0.0% 19.68sec 290472 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil shadowcore_oil_blast 336463 13124 44 8.67 245 491 43.5 43.5 23.0% 0.0% 0.0% 0.0% 6.84sec 13124 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil steady_shot 56641 79832 265 10.31 1260 2519 50.8 51.7 22.5% 0.0% 0.0% 0.0% 5.88sec 114032 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.80sec 0 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil wild_spirits 328231 8846 29 1.77 810 1620 3.0 8.9 22.7% 0.0% 0.0% 0.0% 120.66sec 8846 300.93sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil wild_spirits_proc 328757 243370 809 26.21 1510 3017 43.8 131.5 22.6% 0.0% 0.0% 0.0% 5.85sec 243370 300.93sec
serpentstalkers_trickery serpentstalkers_trickery aimed_shot 19434 740133 2459 28.58 4212 8427 47.8 143.3 22.6% 0.0% 0.0% 0.0% 6.24sec 1057206 300.93sec
serpentstalkers_trickery serpentstalkers_trickery aimed_shot_double_tap 19434 73351 244 2.76 4314 8645 0.0 13.8 22.9% 0.0% 0.0% 0.0% 0.00sec 104774 300.93sec
serpentstalkers_trickery serpentstalkers_trickery augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
serpentstalkers_trickery serpentstalkers_trickery auto_shot 75 112055 372 22.47 811 1622 113.0 112.7 22.6% 0.0% 0.0% 0.0% 2.67sec 160060 300.93sec
serpentstalkers_trickery serpentstalkers_trickery blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.77sec 0 300.93sec
serpentstalkers_trickery serpentstalkers_trickery double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.59sec 0 300.93sec
serpentstalkers_trickery serpentstalkers_trickery dreadfire_vessel 344732 41343 137 0.75 9042 18083 3.8 3.7 22.1% 0.0% 0.0% 0.0% 90.75sec 41343 300.93sec
serpentstalkers_trickery serpentstalkers_trickery eternal_skirmish 323889 11876 39 4.35 445 891 21.8 21.8 22.2% 0.0% 0.0% 0.0% 13.51sec 11876 300.93sec
serpentstalkers_trickery serpentstalkers_trickery flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
serpentstalkers_trickery serpentstalkers_trickery food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
serpentstalkers_trickery serpentstalkers_trickery kill_shot 53351 24773 82 0.91 4248 9576 4.6 4.5 22.5% 0.0% 0.0% 0.0% 13.71sec 35386 300.93sec
serpentstalkers_trickery serpentstalkers_trickery master_marksman ticks -269576 98452 328 66.11 298 0 200.1 330.5 0.0% 0.0% 0.0% 0.0% 1.50sec 98452 300.93sec
serpentstalkers_trickery serpentstalkers_trickery multishot 257620 488214 1622 48.80 1627 3250 81.7 244.7 22.7% 0.0% 0.0% 0.0% 3.66sec 697364 300.93sec
serpentstalkers_trickery serpentstalkers_trickery potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.90sec 0 300.93sec
serpentstalkers_trickery serpentstalkers_trickery rapid_fire ticks -257044 219735 732 24.22 495 989 16.4 121.1 22.6% 0.0% 0.0% 0.0% 18.39sec 313870 300.93sec
serpentstalkers_trickery serpentstalkers_trickery serpent_sting 271788 29775 99 9.51 509 1017 0.0 47.7 22.7% 0.0% 0.0% 0.0% 0.00sec 240810 300.93sec
serpentstalkers_trickery serpentstalkers_trickery serpent_sting ticks -271788 211035 703 70.73 487 974 0.0 353.6 22.6% 0.0% 0.0% 0.0% 0.00sec 240810 300.93sec
serpentstalkers_trickery serpentstalkers_trickery shadowcore_oil_blast 336463 13236 44 8.79 245 489 44.1 44.1 22.7% 0.0% 0.0% 0.0% 6.72sec 13236 300.93sec
serpentstalkers_trickery serpentstalkers_trickery steady_shot 56641 104744 348 13.48 1265 2528 66.7 67.6 22.6% 0.0% 0.0% 0.0% 4.50sec 149616 300.93sec
serpentstalkers_trickery serpentstalkers_trickery trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.78sec 0 300.93sec
serpentstalkers_trickery serpentstalkers_trickery wild_spirits 328231 8860 29 1.78 810 1622 3.0 8.9 22.7% 0.0% 0.0% 0.0% 120.64sec 8860 300.93sec
serpentstalkers_trickery serpentstalkers_trickery wild_spirits_proc 328757 315973 1050 33.97 1511 3022 56.8 170.4 22.8% 0.0% 0.0% 0.0% 4.51sec 315973 300.93sec
soulforge_embers soulforge_embers aimed_shot 19434 721710 2398 27.80 4223 8419 46.5 139.4 22.7% 0.0% 0.0% 0.0% 6.40sec 1030891 300.93sec
soulforge_embers soulforge_embers aimed_shot_double_tap 19434 69696 232 2.63 4309 8640 0.0 13.2 22.4% 0.0% 0.0% 0.0% 0.00sec 99554 300.93sec
soulforge_embers soulforge_embers augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
soulforge_embers soulforge_embers auto_shot 75 113232 376 22.68 812 1624 114.0 113.7 22.6% 0.0% 0.0% 0.0% 2.65sec 161741 300.93sec
soulforge_embers soulforge_embers blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.71sec 0 300.93sec
soulforge_embers soulforge_embers double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.60sec 0 300.93sec
soulforge_embers soulforge_embers dreadfire_vessel 344732 41172 137 0.75 9038 18059 3.8 3.7 21.9% 0.0% 0.0% 0.0% 90.75sec 41172 300.93sec
soulforge_embers soulforge_embers eternal_skirmish 323889 11949 40 4.35 446 892 21.8 21.8 22.8% 0.0% 0.0% 0.0% 13.26sec 11949 300.93sec
soulforge_embers soulforge_embers flare 1543 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 21.43sec 0 300.93sec
soulforge_embers soulforge_embers flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
soulforge_embers soulforge_embers food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
soulforge_embers soulforge_embers kill_shot 53351 22461 75 0.82 4244 9549 4.2 4.1 22.6% 0.0% 0.0% 0.0% 14.62sec 32083 300.93sec
soulforge_embers soulforge_embers master_marksman ticks -269576 92601 309 61.89 299 0 180.4 309.5 0.0% 0.0% 0.0% 0.0% 1.66sec 92601 300.93sec
soulforge_embers soulforge_embers multishot 257620 463088 1539 45.65 1649 3299 76.5 229.0 22.6% 0.0% 0.0% 0.0% 3.90sec 661474 300.93sec
soulforge_embers soulforge_embers potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.81sec 0 300.93sec
soulforge_embers soulforge_embers rapid_fire ticks -257044 214569 715 23.68 494 989 15.8 118.4 22.7% 0.0% 0.0% 0.0% 19.05sec 306491 300.93sec
soulforge_embers soulforge_embers shadowcore_oil_blast 336463 13047 43 8.64 245 491 43.3 43.3 22.7% 0.0% 0.0% 0.0% 6.93sec 13047 300.93sec
soulforge_embers soulforge_embers soulforge_embers ticks -336746 344148 1147 70.08 801 1601 14.4 350.4 22.6% 0.0% 0.0% 0.0% 21.43sec 344148 300.93sec
soulforge_embers soulforge_embers steady_shot 56641 86542 288 11.13 1265 2529 54.9 55.8 22.6% 0.0% 0.0% 0.0% 5.46sec 123616 300.93sec
soulforge_embers soulforge_embers tar_trap 187698 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 43.03sec 0 300.93sec
soulforge_embers soulforge_embers trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.72sec 0 300.93sec
soulforge_embers soulforge_embers wild_spirits 328231 8210 27 1.77 751 1501 3.0 8.9 22.8% 0.0% 0.0% 0.0% 120.75sec 8210 300.93sec
soulforge_embers soulforge_embers wild_spirits_proc 328757 221002 734 23.74 1515 3030 39.7 119.1 22.5% 0.0% 0.0% 0.0% 6.46sec 221002 300.93sec
surging_shots surging_shots aimed_shot 19434 684926 2276 26.60 4193 8345 44.5 133.4 22.6% 0.0% 0.0% 0.0% 6.71sec 978348 300.93sec
surging_shots surging_shots aimed_shot_double_tap 19434 75048 249 2.84 4325 8597 0.0 14.2 22.2% 0.0% 0.0% 0.0% 0.00sec 107198 300.93sec
surging_shots surging_shots augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
surging_shots surging_shots auto_shot 75 103757 345 20.91 807 1615 105.1 104.9 22.6% 0.0% 0.0% 0.0% 2.87sec 148206 300.93sec
surging_shots surging_shots blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.79sec 0 300.93sec
surging_shots surging_shots double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.61sec 0 300.93sec
surging_shots surging_shots dreadfire_vessel 344732 41429 138 0.75 9043 18097 3.8 3.7 22.5% 0.0% 0.0% 0.0% 90.77sec 41429 300.93sec
surging_shots surging_shots eternal_skirmish 323889 11960 40 4.36 446 892 21.8 21.8 22.7% 0.0% 0.0% 0.0% 13.33sec 11960 300.93sec
surging_shots surging_shots flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
surging_shots surging_shots food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
surging_shots surging_shots kill_shot 53351 23757 79 0.87 4248 9544 4.4 4.4 22.5% 0.0% 0.0% 0.0% 13.98sec 33935 300.93sec
surging_shots surging_shots master_marksman ticks -269576 101313 338 67.22 301 0 212.7 336.1 0.0% 0.0% 0.0% 0.0% 1.42sec 101313 300.93sec
surging_shots surging_shots multishot 257620 487798 1621 49.92 1588 3177 83.7 250.4 22.7% 0.0% 0.0% 0.0% 3.58sec 696771 300.93sec
surging_shots surging_shots potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.87sec 0 300.93sec
surging_shots surging_shots rapid_fire ticks -257044 364146 1214 31.70 626 1252 21.9 158.5 22.7% 0.0% 0.0% 0.0% 13.76sec 520146 300.93sec
surging_shots surging_shots shadowcore_oil_blast 336463 13137 44 8.72 245 491 43.7 43.7 22.4% 0.0% 0.0% 0.0% 6.81sec 13137 300.93sec
surging_shots surging_shots steady_shot 56641 95092 316 12.28 1260 2520 60.7 61.6 22.5% 0.0% 0.0% 0.0% 4.94sec 135830 300.93sec
surging_shots surging_shots trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.79sec 0 300.93sec
surging_shots surging_shots wild_spirits 328231 8881 30 1.78 810 1622 3.0 8.9 23.1% 0.0% 0.0% 0.0% 120.65sec 8881 300.93sec
surging_shots surging_shots wild_spirits_proc 328757 234822 780 25.29 1509 3018 42.3 126.8 22.7% 0.0% 0.0% 0.0% 6.10sec 234822 300.93sec
trapping_app trapping_app aimed_shot 19434 741076 2463 28.58 4221 8415 47.8 143.3 22.6% 0.0% 0.0% 0.0% 6.24sec 1058553 300.93sec
trapping_app trapping_app aimed_shot_double_tap 19434 73014 243 2.74 4333 8670 0.0 13.7 22.5% 0.0% 0.0% 0.0% 0.00sec 104294 300.93sec
trapping_app trapping_app augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
trapping_app trapping_app auto_shot 75 112422 374 22.48 811 1625 113.0 112.8 22.8% 0.0% 0.0% 0.0% 2.67sec 160583 300.93sec
trapping_app trapping_app blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.77sec 0 300.93sec
trapping_app trapping_app double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.60sec 0 300.93sec
trapping_app trapping_app dreadfire_vessel 344732 41204 137 0.75 9051 18086 3.8 3.7 21.8% 0.0% 0.0% 0.0% 90.73sec 41204 300.93sec
trapping_app trapping_app eternal_skirmish 323889 12007 40 4.36 446 893 21.9 21.9 22.9% 0.0% 0.0% 0.0% 13.47sec 12007 300.93sec
trapping_app trapping_app flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
trapping_app trapping_app food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.93sec
trapping_app trapping_app kill_shot 53351 24792 82 0.90 4256 9585 4.6 4.5 22.7% 0.0% 0.0% 0.0% 13.59sec 35413 300.93sec
trapping_app trapping_app master_marksman ticks -269576 96772 323 64.25 301 0 189.3 321.2 0.0% 0.0% 0.0% 0.0% 1.58sec 96772 300.93sec
trapping_app trapping_app multishot 257620 488383 1623 48.82 1627 3251 81.8 244.9 22.6% 0.0% 0.0% 0.0% 3.66sec 697606 300.93sec
trapping_app trapping_app potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.96sec 0 300.93sec
trapping_app trapping_app rapid_fire ticks -257044 220352 735 24.30 495 989 16.4 121.5 22.6% 0.0% 0.0% 0.0% 18.30sec 314750 300.93sec
trapping_app trapping_app shadowcore_oil_blast 336463 13140 44 8.70 245 491 43.6 43.6 22.7% 0.0% 0.0% 0.0% 6.74sec 13140 300.93sec
trapping_app trapping_app steady_shot 56641 104671 348 13.46 1266 2530 66.6 67.5 22.5% 0.0% 0.0% 0.0% 4.51sec 149513 300.93sec
trapping_app trapping_app trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.79sec 0 300.93sec
trapping_app trapping_app wild_spirits 328231 8825 29 1.78 810 1619 3.0 8.9 22.4% 0.0% 0.0% 0.0% 120.65sec 8825 300.93sec
trapping_app trapping_app wild_spirits_proc 328757 243537 809 26.23 1509 3018 43.9 131.6 22.7% 0.0% 0.0% 0.0% 5.88sec 243537 300.93sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
31268.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 53.9sec 12.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 158.5s

Stack Uptimes

  • Health Decade (0 - 10)_1:12.73%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 30.0sec 9.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.0s

Stack Uptimes

  • Health Decade (10 - 20)_1:9.17%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 33.6sec 11.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 46.4s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.19%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.0sec 12.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.8s / 51.3s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.45%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.7sec 11.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.2s / 48.1s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.33%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 32.4sec 10.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.9s / 40.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.91%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.9sec 11.77% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.1s / 46.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.77%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.0sec 10.44% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.4s / 44.3s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.44%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 17.5sec 5.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 28.3s

Stack Uptimes

  • Health Decade (80 - 90)_1:5.88%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 15.9sec 4.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.0s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.19%
Sinful Revelation 6.7 1.7 40.4sec 31.4sec 11.2sec 24.90% 0.00% 1.7 (1.7) 6.5

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 222.4s
  • trigger_min/max:0.0s / 215.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.1s

Stack Uptimes

  • sinful_revelation_1:24.90%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.5 1.6 41.2sec 32.1sec 11.1sec 23.99% 0.00% 1.6 (1.6) 6.3

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 236.4s
  • trigger_min/max:0.1s / 236.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.2s

Stack Uptimes

  • sinful_revelation_1:23.99%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.0 1.3 44.6sec 35.7sec 10.9sec 21.87% 0.00% 1.3 (1.3) 5.8

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 263.4s
  • trigger_min/max:0.1s / 263.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 37.5s

Stack Uptimes

  • sinful_revelation_1:21.87%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.7 1.6 40.3sec 31.5sec 11.0sec 24.66% 0.00% 1.6 (1.6) 6.4

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 204.7s
  • trigger_min/max:0.1s / 197.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.0s

Stack Uptimes

  • sinful_revelation_1:24.66%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.6 1.6 41.2sec 32.2sec 11.1sec 24.24% 0.00% 1.6 (1.6) 6.3

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 253.8s
  • trigger_min/max:0.1s / 253.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.4s

Stack Uptimes

  • sinful_revelation_1:24.24%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.9 1.7 39.8sec 31.0sec 11.1sec 25.54% 0.00% 1.7 (1.7) 6.6

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 237.4s
  • trigger_min/max:0.2s / 237.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.0s

Stack Uptimes

  • sinful_revelation_1:25.54%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 7.0 1.9 39.2sec 30.0sec 11.2sec 26.25% 0.00% 1.9 (1.9) 6.8

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 299.1s
  • trigger_min/max:0.2s / 288.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 46.6s

Stack Uptimes

  • sinful_revelation_1:26.25%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.5 1.5 41.4sec 32.6sec 11.0sec 23.98% 0.00% 1.5 (1.5) 6.3

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 257.5s
  • trigger_min/max:0.1s / 257.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.1s

Stack Uptimes

  • sinful_revelation_1:23.98%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 7.1 1.9 38.9sec 29.8sec 11.2sec 26.28% 0.00% 1.9 (1.9) 6.8

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 235.9s
  • trigger_min/max:0.1s / 235.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.4s

Stack Uptimes

  • sinful_revelation_1:26.28%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
Fluffy_Pillow Damage Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1323
Mean 33482.64
Minimum 31808.03
Maximum 35522.06
Spread ( max - min ) 3714.03
Range [ ( max - min ) / 2 * 100% ] 5.55%
Standard Deviation 592.6945
5th Percentile 32483.82
95th Percentile 34413.79
( 95th Percentile - 5th Percentile ) 1929.97
Mean Distribution
Standard Deviation 16.2949
95.00% Confidence Interval ( 33450.70 - 33514.57 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1204
0.1 Scale Factor Error with Delta=300 2999
0.05 Scale Factor Error with Delta=300 11996
0.01 Scale Factor Error with Delta=300 299879
HPS
Fluffy_Pillow Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 234
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 10968350 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
16147.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 58.5sec 13.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 155.6s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.77%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 32.0sec 9.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 56.5s

Stack Uptimes

  • Health Decade (10 - 20)_1:9.69%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 35.5sec 11.76% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 50.2s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.76%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.7sec 12.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.4s / 57.1s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.70%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 31.0sec 10.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.3s / 55.8s

Stack Uptimes

  • Health Decade (40 - 50)_1:10.47%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 32.9sec 11.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.5s / 43.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.10%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.2sec 12.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.3s / 52.8s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.56%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 29.1sec 9.79% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.2s / 44.0s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.79%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 13.0sec 4.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.5s / 24.3s

Stack Uptimes

  • Health Decade (80 - 90)_1:4.39%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.8sec 3.80% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.6s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.80%
Sinful Revelation 1.6 0.1 78.2sec 72.3sec 10.0sec 5.42% 0.00% 0.1 (0.1) 1.6

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 279.9s
  • trigger_min/max:0.1s / 279.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • sinful_revelation_1:5.42%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.7 0.1 76.4sec 70.6sec 10.1sec 5.65% 0.00% 0.1 (0.1) 1.6

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 305.9s
  • trigger_min/max:0.1s / 305.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 32.3s

Stack Uptimes

  • sinful_revelation_1:5.65%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
enemy2 Damage Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1323
Mean 17238.87
Minimum 16023.13
Maximum 18356.27
Spread ( max - min ) 2333.13
Range [ ( max - min ) / 2 * 100% ] 6.77%
Standard Deviation 435.6341
5th Percentile 16520.61
95th Percentile 17986.90
( 95th Percentile - 5th Percentile ) 1466.29
Mean Distribution
Standard Deviation 11.9768
95.00% Confidence Interval ( 17215.39 - 17262.34 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2454
0.1 Scale Factor Error with Delta=300 1621
0.05 Scale Factor Error with Delta=300 6481
0.01 Scale Factor Error with Delta=300 162005
HPS
enemy2 Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 234
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 4636145 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
16474.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 59.6sec 13.42% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 168.6s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.48%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 31.5sec 9.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 57.3s

Stack Uptimes

  • Health Decade (10 - 20)_1:9.41%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 49.4s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.47%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 38.1sec 12.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.2s / 55.9s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.88%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 31.2sec 10.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.7s / 58.1s

Stack Uptimes

  • Health Decade (40 - 50)_1:10.54%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 32.1sec 10.82% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.6s / 43.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.82%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.5sec 12.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.6s / 53.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.67%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 30.0sec 10.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:11.1s / 46.1s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.13%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 14.0sec 4.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 25.6s

Stack Uptimes

  • Health Decade (80 - 90)_1:4.71%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 15.2sec 3.97% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.7s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.97%
Sinful Revelation 5.6 1.1 47.5sec 38.5sec 10.8sec 20.04% 0.00% 1.1 (1.1) 5.4

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 280.8s
  • trigger_min/max:0.1s / 280.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.3s

Stack Uptimes

  • sinful_revelation_1:20.04%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.7 1.7 41.6sec 32.0sec 11.1sec 24.85% 0.00% 1.7 (1.7) 6.5

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 250.0s
  • trigger_min/max:0.0s / 250.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.2s

Stack Uptimes

  • sinful_revelation_1:24.85%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 7.3 2.0 37.9sec 28.9sec 11.2sec 27.32% 0.00% 2.0 (2.0) 7.1

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 210.3s
  • trigger_min/max:0.1s / 210.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 39.2s

Stack Uptimes

  • sinful_revelation_1:27.32%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.7 1.7 41.5sec 32.0sec 11.1sec 24.59% 0.00% 1.7 (1.7) 6.4

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 225.7s
  • trigger_min/max:0.0s / 225.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.5s

Stack Uptimes

  • sinful_revelation_1:24.59%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 5.7 1.2 46.6sec 37.4sec 10.9sec 20.47% 0.00% 1.2 (1.2) 5.5

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 310.8s
  • trigger_min/max:0.1s / 299.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 37.0s

Stack Uptimes

  • sinful_revelation_1:20.47%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.4 1.5 42.4sec 33.3sec 11.0sec 23.54% 0.00% 1.5 (1.5) 6.2

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 240.2s
  • trigger_min/max:0.1s / 240.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.9s

Stack Uptimes

  • sinful_revelation_1:23.54%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.4 1.5 42.6sec 33.5sec 11.0sec 23.27% 0.00% 1.5 (1.5) 6.1

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 270.0s
  • trigger_min/max:0.0s / 270.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.5s

Stack Uptimes

  • sinful_revelation_1:23.27%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.8 1.7 40.9sec 31.7sec 11.1sec 25.20% 0.00% 1.7 (1.7) 6.6

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 247.5s
  • trigger_min/max:0.0s / 247.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.6s

Stack Uptimes

  • sinful_revelation_1:25.20%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.3 1.4 43.3sec 34.2sec 11.0sec 22.92% 0.00% 1.4 (1.4) 6.1

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 238.2s
  • trigger_min/max:0.0s / 238.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 42.1s

Stack Uptimes

  • sinful_revelation_1:22.92%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1323
Mean 300.93
Minimum 240.34
Maximum 359.63
Spread ( max - min ) 119.29
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
enemy3 Damage Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1323
Mean 17605.34
Minimum 16387.11
Maximum 18846.29
Spread ( max - min ) 2459.17
Range [ ( max - min ) / 2 * 100% ] 6.98%
Standard Deviation 436.8339
5th Percentile 16921.22
95th Percentile 18342.73
( 95th Percentile - 5th Percentile ) 1421.51
Mean Distribution
Standard Deviation 12.0098
95.00% Confidence Interval ( 17581.80 - 17628.88 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2366
0.1 Scale Factor Error with Delta=300 1629
0.05 Scale Factor Error with Delta=300 6516
0.01 Scale Factor Error with Delta=300 162899
HPS
enemy3 Healing Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1323
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 234
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 5081232 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.